GPR19 (NM_006143) Human Tagged ORF Clone

CAT#: RG220379

GPR19 (GFP-tagged) - Human G protein-coupled receptor 19 (GPR19)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPR19 (NM_006143) Human Tagged ORF Clone
Symbol GPR19
Synonyms G protein-coupled receptor 19
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG220379 representing NM_006143
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTTTTGCTCACAGAATGGATAACAGCAAGCCACATTTGATTATTCCTACACTTCTGGTGCCCCTCC
AAAACCGCAGCTGCACTGAAACAGCCACACCTCTGCCAAGCCAATACCTGATGGAATTAAGTGAGGAGCA
CAGTTGGATGAGCAACCAAACAGACCTTCACTATGTGCTGAAACCCGGGGAAGTGGCCACAGCCAGCATC
TTCTTTGGGATTCTGTGGTTGTTTTCTATCTTCGGCAATTCCCTGGTTTGTTTGGTCATCCATAGGAGTA
GGAGGACTCAGTCTACCACCAACTACTTTGTGGTCTCCATGGCATGTGCTGACCTTCTCATCAGCGTTGC
CAGCACGCCTTTCGTCCTGCTCCAGTTCACCACTGGAAGGTGGACGCTGGGTAGTGCAACGTGCAAGGTT
GTGCGATATTTTCAATATCTCACTCCAGGTGTCCAGATCTACGTTCTCCTCTCCATCTGCATAGACCGGT
TCTACACCATCGTCTATCCTCTGAGCTTCAAGGTGTCCAGAGAAAAAGCCAAGAAAATGATTGCGGCATC
GTGGATCTTTGATGCAGGCTTTGTGACCCCTGTGCTCTTTTTCTATGGCTCCAACTGGGACAGTCATTGT
AACTATTTCCTCCCCTCCTCTTGGGAAGGCACTGCCTACACTGTCATCCACTTCTTGGTGGGCTTTGTGA
TTCCATCTGTCCTCATAATTTTATTTTACCAAAAGGTCATAAAATATATTTGGAGAATAGGCACAGATGG
CCGAACGGTGAGGAGGACAATGAACATTGTCCCTCGGACAAAAGTGAAAACTATCAAGATGTTCCTCATT
TTAAATCTGTTGTTTTTGCTCTCCTGGCTGCCTTTTCATGTAGCTCAGCTATGGCACCCCCATGAACAAG
ACTATAAGAAAAGTTCCCTTGTTTTCACAGCTATCACATGGATATCCTTTAGTTCTTCAGCCTCTAAACC
TACTCTGTATTCAATTTATAATGCCAATTTTCGGAGAGGGATGAAAGAGACTTTTTGCATGTCCTCTATG
AAATGTTACCGAAGCAATGCCTATACTATCACAACAAGTTCAAGGATGGCCAAAAAAAACTACGTTGGCA
TTTCAGAAATCCCTTCCATGGCCAAAACTATTACCAAAGACTCGATCTATGACTCATTTGACAGAGAAGC
CAAGGAAAAAAAGCTTGCTTGGCCCATTAACTCAAATCCACCAAATACTTTTGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG220379 representing NM_006143
Red=Cloning site Green=Tags(s)

MVFAHRMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTDLHYVLKPGEVATASI
FFGILWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVLLQFTTGRWTLGSATCKV
VRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMIAASWIFDAGFVTPVLFFYGSNWDSHC
NYFLPSSWEGTAYTVIHFLVGFVIPSVLIILFYQKVIKYIWRIGTDGRTVRRTMNIVPRTKVKTIKMFLI
LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLYSIYNANFRRGMKETFCMSSM
KCYRSNAYTITTSSRMAKKNYVGISEIPSMAKTITKDSIYDSFDREAKEKKLAWPINSNPPNTFV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_006143
ORF Size 1245 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006143.1, NP_006134
RefSeq Size 1409
RefSeq ORF 1248
Locus ID 2842
Cytogenetics 12p13.1
Protein Families GPCR, Transmembrane, Druggable Genome
Gene Summary Orphan receptor. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations