CNO6L(CNOT6L) (NM_144571) Human Tagged ORF Clone

CAT#: RG219766

CNOT6L (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 773.00


Availability*
3 Weeks

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CNO6L(CNOT6L) (NM_144571) Human Tagged ORF Clone
Symbol CNOT6L
Synonyms CCR4b; CCR4b
Vector pCMV6-AC-GFP
Sequence Data
>RG219766 representing NM_144571
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGACTAATAGGGATGCCAAAGGAAAAATATGATCCTCCAGATCCTCGCAGAATTTATACCATCATGT
CAGCAGAGGAGGTAGCCAATGGGAAAAAATCTCACTGGGCAGAATTAGAAATCTCGGGTAGAGTGCGGAG
CCTAAGTACATCACTTTGGTCATTGACACACTTGACAGCGCTGCACCTAAATGACAATTACCTTAGTCGC
ATTCCACCTGATATTGCCAAGCTTCATAATCTGGTTTACCTGGATCTGTCATCCAATAAACTCAGAAGTT
TACCAGCAGAACTAGGAAACATGGTGTCTCTCAGGGAATTGCTTTTAAATAACAATCTGTTACGGGTTTT
GCCTTATGAACTTGGTCGGCTCTTCCAGCTACAAACTCTAGGTTTGAAAGGCAATCCTTTATCACAGGAT
ATTCTCAACTTATACCAGGACCCAGATGGAACCCGAAAGCTACTGAACTTCATGCTTGACAATCTCGCAG
TTCATCCAGAGCAGCTTCCTCCGAGGCCATGGATTACATTAAAAGAACGAGACCAAATTCTGCCGTCAGC
ATCATTCACGGTTATGTGTTACAATGTGTTATGTGATAAATACGCTACCCGGCAGCTATATGGCTATTGC
CCATCCTGGGCATTAAACTGGGAATACAGGAAAAAGGGAATTATGGAAGAAATTGTTAACTGTGACGCAG
ATATCATTAGTCTTCAGGAAGTGGAAACAGAGCAATACTTCACTCTCTTTCTGCCAGCATTGAAGGAGCG
TGGATATGATGGATTTTTTTCTCCAAAGTCACGTGCCAAAATCATGTCTGAGCAGGAGAGAAAGCATGTA
GATGGTTGTGCAATATTCTTCAAAACAGAAAAATTTACATTGGTGCAGAAGCATACAGTGGAATTTAACC
AAGTGGCGATGGCTAATTCAGATGGATCCGAAGCTATGCTGAACAGAGTGATGACAAAAGATAACATTGG
TGTCGCTGTGGTATTAGAGGTCCACAAAGAACTATTTGGAGCAGGTATGAAGCCTATTCATGCTGCAGAC
AAACAGCTGCTTATAGTGGCAAATGCCCACATGCATTGGGACCCAGAGTATTCTGATGTGAAGCTCATCC
AGACCATGATGTTTGTCTCAGAGGTTAAAAACATTCTGGAGAAAGCCTCTAGTAGGCCTGGAAGCCCAAC
TGCAGATCCTAATTCCATCCCGCTGGTGCTATGTGCAGATCTTAACTCATTGCCAGATTCAGGTGTTGTG
GAATACTTAAGCAATGGAGGAGTAGCTGACAACCATAAAGACTTCAAGGAACTAAGGTACAATGAGTGTC
TTATGAACTTCAGCTGCAATGGAAAGAATGGAAGCTCAGAAGGGAGAATCACACATGGCTTCCAACTTAA
GAGCGCCTATGAAAATAACTTGATGCCTTACACCAATTACACCTTTGATTTCAAAGGCGTGATTGACTAC
ATTTTCTATTCCAAGACTCATATGAACGTGCTTGGTGTCCTGGGGCCTTTAGATCCTCAATGGCTGGTTG
AGAACAACATCACTGGGTGTCCACACCCTCACATCCCTTCAGACCACTTCTCACTGTTAACACAACTTGA
ACTCCACCCTCCACTCCTGCCTCTTGTCAATGGTGTTCACTTGCCTAATCGGAGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG219766 representing NM_144571
Red=Cloning site Green=Tags(s)

MRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLWSLTHLTALHLNDNYLSR
IPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNNNLLRVLPYELGRLFQLQTLGLKGNPLSQD
ILNLYQDPDGTRKLLNFMLDNLAVHPEQLPPRPWITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYC
PSWALNWEYRKKGIMEEIVNCDADIISLQEVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHV
DGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAAD
KQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVV
EYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYENNLMPYTNYTFDFKGVIDY
IFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQLELHPPLLPLVNGVHLPNRR

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_144571
ORF Size 1665 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_144571.2, NP_653172
RefSeq Size 8794
RefSeq ORF 1668
Locus ID 246175
Cytogenetics 4q21.1
Domains LRR, LRR_TYP, Exo_endo_phos, LRR_PS
Protein Pathways RNA degradation
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)