CACNA1G(CACNA1G) (NM_198385) Human Tagged ORF Clone

CAT#: RG219695

CACNA1G (GFP-tagged) - Human calcium channel, voltage-dependent, T type, alpha 1G subunit (CACNA1G), transcript variant 4

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 2,194.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CACNA1G(CACNA1G) (NM_198385) Human Tagged ORF Clone
Symbol CACNA1G
Synonyms Ca(V)T.1; Cav3.1; NBR13
Vector pCMV6-AC-GFP
Sequence Data
>RG219695 representing NM_198385
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGAGGAGGAGGATGGAGCGGGCGCCGAGGAGTCGGGACAGCCCCGGAGCTTCATGCGGCTCAACG
ACCTGTCGGGGGCCGGGGGCCGGCCGGGGCCGGGGTCAGCAGAAAAGGACCCGGGCAGCGCGGACTCCGA
GGCGGAGGGGCTGCCGTACCCGGCGCTGGCCCCGGTGGTTTTCTTCTACTTGAGCCAGGACAGCCGCCCG
CGGAGCTGGTGTCTCCGCACGGTCTGTAACCCCTGGTTTGAGCGCATCAGCATGTTGGTCATCCTTCTCA
ACTGCGTGACCCTGGGCATGTTCCGGCCATGCGAGGACATCGCCTGTGACTCCCAGCGCTGCCGGATCCT
GCAGGCCTTTGATGACTTCATCTTTGCCTTCTTTGCCGTGGAGATGGTGGTGAAGATGGTGGCCTTGGGC
ATCTTTGGGAAAAAGTGTTACCTGGGAGACACTTGGAACCGGCTTGACTTTTTCATCGTCATCGCAGGGA
TGCTGGAGTACTCGCTGGACCTGCAGAACGTCAGCTTCTCAGCTGTCAGGACAGTCCGTGTGCTGCGACC
GCTCAGGGCCATTAACCGGGTGCCCAGCATGCGCATCCTTGTCACGTTGCTGCTGGATACGCTGCCCATG
CTGGGCAACGTCCTGCTGCTCTGCTTCTTCGTCTTCTTCATCTTCGGCATCGTCGGCGTCCAGCTGTGGG
CAGGGCTGCTTCGGAACCGATGCTTCCTACCTGAGAATTTCAGCCTCCCCCTGAGCGTGGACCTGGAGCG
CTATTACCAGACAGAGAACGAGGATGAGAGCCCCTTCATCTGCTCCCAGCCACGCGAGAACGGCATGCGG
TCCTGCAGAAGCGTGCCCACGCTGCGCGGGGACGGGGGCGGTGGCCCACCTTGCGGTCTGGACTATGAGG
CCTACAACAGCTCCAGCAACACCACCTGTGTCAACTGGAACCAGTACTACACCAACTGCTCAGCGGGGGA
GCACAACCCCTTCAAGGGCGCCATCAACTTTGACAACATTGGCTATGCCTGGATCGCCATCTTCCAGGTC
ATCACGCTGGAGGGCTGGGTCGACATCATGTACTTTGTGATGGATGCTCATTCCTTCTACAATTTCATCT
ACTTCATCCTCCTCATCATCGTGGGCTCCTTCTTCATGATCAACCTGTGCCTGGTGGTGATTGCCACGCA
GTTCTCAGAGACCAAGCAGCGGGAAAGCCAGCTGATGCGGGAGCAGCGTGTGCGGTTCCTGTCCAACGCC
AGCACCCTGGCTAGCTTCTCTGAGCCCGGCAGCTGCTATGAGGAGCTGCTCAAGTACCTGGTGTACATCC
TTCGTAAGGCAGCCCGCAGGCTGGCTCAGGTCTCTCGGGCAGCAGGTGTGCGGGTTGGGCTGCTCAGCAG
CCCAGCACCCCTCGGGGGCCAGGAGACCCAGCCCAGCAGCAGCTGCTCTCGCTCCCACCGCCGCCTATCC
GTCCACCACCTGGTGCACCACCACCACCACCATCACCACCACTACCACCTGGGCAATGGGACGCTCAGGG
CCCCCCGGGCCAGCCCGGAGATCCAGGACAGGGATGCCAATGGGTCCCGCCGGCTCATGCTGCCACCACC
CTCGACGCCTGCCCTCTCCGGGGCCCCCCCTGGTGGCGCAGAGTCTGTGCACAGCTTCTACCATGCCGAC
TGCCACTTAGAGCCAGTCCGCTGCCAGGCGCCCCCTCCCAGGTCCCCATCTGAGGCATCCGGCAGGACTG
TGGGCAGCGGGAAGGTGTATCCCACCGTGCACACCAGCCCTCCACCGGAGACGCTGAAGGAGAAGGCACT
AGTAGAGGTGGCTGCCAGCTCTGGGCCCCCAACCCTCACCAGCCTCAACATCCCACCCGGGCCCTACAGC
TCCATGCACAAGCTGCTGGAGACACAGAGTACAGGTGCCTGCCAAAGCTCTTGCAAGATCTCCAGCCCTT
GCTTGAAAGCAGACAGTGGAGCCTGTGGTCCAGACAGCTGCCCCTACTGTGCCCGGGCCGGGGCAGGGGA
GGTGGAGCTCGCCGACCGTGAAATGCCTGACTCAGACAGCGAGGCAGTTTATGAGTTCACACAGGATGCC
CAGCACAGCGACCTCCGGGACCCCCACAGCCGGCGGCAACGGAGCCTGGGCCCAGATGCAGAGCCCAGCT
CTGTGCTGGCCTTCTGGAGGCTAATCTGTGACACCTTCCGAAAGATTGTGGACAGCAAGTACTTTGGCCG
GGGAATCATGATCGCCATCCTGGTCAACACACTCAGCATGGGCATCGAATACCACGAGCAGCCCGAGGAG
CTTACCAACGCCCTAGAAATCAGCAACATCGTCTTCACCAGCCTCTTTGCCCTGGAGATGCTGCTGAAGC
TGCTTGTGTATGGTCCCTTTGGCTACATCAAGAATCCCTACAACATCTTCGATGGTGTCATTGTGGTCAT
CAGCGTGTGGGAGATCGTGGGCCAGCAGGGGGGCGGCCTGTCGGTGCTGCGGACCTTCCGCCTGATGCGT
GTGCTGAAGCTGGTGCGCTTCCTGCCGGCGCTGCAGCGGCAGCTGGTGGTGCTCATGAAGACCATGGACA
ACGTGGCCACCTTCTGCATGCTGCTTATGCTCTTCATCTTCATCTTCAGCATCCTGGGCATGCATCTCTT
CGGCTGCAAGTTTGCCTCTGAGCGGGATGGGGACACCCTGCCAGACCGGAAGAATTTTGACTCCTTGCTC
TGGGCCATCGTCACTGTCTTTCAGATCCTGACCCAGGAGGACTGGAACAAAGTCCTCTACAATGGTATGG
CCTCCACGTCGTCCTGGGCGGCCCTTTATTTCATTGCCCTCATGACCTTCGGCAACTACGTGCTCTTCAA
TTTGCTGGTCGCCATTCTGGTGGAGGGCTTCCAGGCGGAGGAAATCAGCAAACGGGAAGATGCGAGTGGA
CAGTTAAGCTGTATTCAGCTGCCTGTCGACTCCCAGGGGGGAGATGCCAACAAGTCCGAATCAGAGCCCG
ATTTCTTCTCACCCAGCCTGGATGGTGATGGGGACAGGAAGAAGTGCTTGGCCTTGGTGTCCCTGGGAGA
GCACCCGGAGCTGCGGAAGAGCCTGCTGCCGCCTCTCATCATCCACACGGCCGCCACACCCATGTCGCTG
CCCAAGAGCACCAGCACGGGCCTGGGCGAGGCGCTGGGCCCTGCGTCGCGCCGCACCAGCAGCAGCGGGT
CGGCAGAGCCTGGGGCGGCCCACGAGATGAAGTCACCGCCCAGCGCCCGCAGCTCTCCGCACAGCCCCTG
GAGCGCTGCAAGCAGCTGGACCAGCAGGCGCTCCAGCCGGAACAGCCTCGGCCGTGCACCCAGCCTGAAG
CGGAGAAGCCCAAGTGGAGAGCGGCGGTCCCTGTTGTCGGGAGAAGGCCAGGAGAGCCAGGATGAAGAGG
AGAGCTCAGAAGAGGAGCGGGCCAGCCCTGCGGGCAGTGACCATCGCCACAGGGGGTCCCTGGAGCGGGA
GGCCAAGAGTTCCTTTGACCTGCCAGACACACTGCAGGTGCCAGGGCTGCATCGCACTGCCAGTGGCCGA
GGGTCTGCTTCTGAGCACCAGGACTGCAATGGCAAGTCGGCTTCAGGGCGCCTGGCCCGGGCCCTGCGGC
CTGATGACCCCCCACTGGATGGGGATGACGCCGATGACGAGGGCAACCTGAGCAAAGGGGAACGGGTCCG
CGCGTGGATCCGAGCCCGACTCCCTGCCTGCTGCCTCGAGCGAGACTCCTGGTCAGCCTACATCTTCCCT
CCTCAGTCCAGGTTCCGCCTCCTGTGTCACCGGATCATCACCCACAAGATGTTCGACCACGTGGTCCTTG
TCATCATCTTCCTTAACTGCATCACCATCGCCATGGAGCGCCCCAAAATTGACCCCCACAGCGCTGAACG
CATCTTCCTGACCCTCTCCAATTACATCTTCACCGCAGTCTTTCTGGCTGAAATGACAGTGAAGGTGGTG
GCACTGGGCTGGTGCTTCGGGGAGCAGGCGTACCTGCGGAGCAGTTGGAACGTGCTGGACGGGCTGTTGG
TGCTCATCTCCGTCATCGACATTCTGGTGTCCATGGTCTCTGACAGCGGCACCAAGATCCTGGGCATGCT
GAGGGTGCTGCGGCTGCTGCGGACCCTGCGCCCGCTCAGGGTGATCAGCCGGGCGCAGGGGCTGAAGCTG
GTGGTGGAGACGCTGATGTCCTCACTGAAACCCATCGGCAACATTGTAGTCATCTGCTGTGCCTTCTTCA
TCATTTTCGGCATCTTGGGGGTGCAGCTCTTCAAAGGGAAGTTTTTCGTGTGCCAGGGCGAGGATACCAG
GAACATCACCAATAAATCGGACTGTGCCGAGGCCAGTTACCGGTGGGTCCGGCACAAGTACAACTTTGAC
AACCTTGGCCAGGCCCTGATGTCCCTGTTCGTTTTGGCCTCCAAGGATGGTTGGGTGGACATCATGTACG
ATGGGCTGGATGCTGTGGGCGTGGACCAGCAGCCCATCATGAACCACAACCCCTGGATGCTGCTGTACTT
CATCTCGTTCCTGCTCATTGTGGCCTTCTTTGTCCTGAACATGTTTGTGGGTGTGGTGGTGGAGAACTTC
CACAAGTGTCGGCAGCACCAGGAGGAAGAGGAGGCCCGGCGGCGGGAGGAGAAGCGCCTACGAAGACTGG
AGAAAAAGAGAAGGAATCTAATGCTGGACGATGTAATTGCTTCCGGCAGCTCAGCCAGCGCTGCGTCAGA
AGCCCAGTGCAAACCTTACTACTCCGACTACTCCCGCTTCCGGCTCCTCGTCCACCACTTGTGCACCAGC
CACTACCTGGACCTCTTCATCACAGGTGTCATCGGGCTGAACGTGGTCACCATGGCCATGGAGCACTACC
AGCAGCCCCAGATTCTGGATGAGGCTCTGAAGATCTGCAACTACATCTTCACTGTCATCTTTGTCTTGGA
GTCAGTTTTCAAACTTGTGGCCTTTGGTTTCCGTCGGTTCTTCCAGGACAGGTGGAACCAGCTGGACCTG
GCCATTGTGCTGCTGTCCATCATGGGCATCACGCTGGAGGAAATCGAGGTCAACGCCTCGCTGCCCATCA
ACCCCACCATCATCCGCATCATGAGGGTGCTGCGCATTGCCCGAGTGCTGAAGCTGCTGAAGATGGCTGT
GGGCATGCGGGCGCTGCTGGACACGGTGATGCAGGCCCTGCCCCAGGTGGGGAACCTGGGACTTCTCTTC
ATGTTGTTGTTTTTCATCTTTGCAGCTCTGGGCGTGGAGCTCTTTGGAGACCTGGAGTGTGACGAGACAC
ACCCCTGTGAGGGCCTGGGCCGTCATGCCACCTTTCGGAACTTTGGCATGGCCTTCCTAACCCTCTTCCG
AGTCTCCACAGGTGACAATTGGAATGGCATTATGAAGGACACCCTCCGGGACTGTGACCAGGAGTCCACC
TGCTACAACACGGTCATCTCGCCTATCTACTTTGTGTCCTTCGTGCTGACGGCCCAGTTCGTGCTAGTCA
ACGTGGTGATCGCCGTGCTGATGAAGCACCTGGAGGAGAGCAACAAGGAGGCCAAGGAGGAGGCCGAGCT
AGAGGCTGAGCTGGAGCTGGAGATGAAGACCCTCAGCCCCCAGCCCCACTCGCCACTGGGCAGCCCCTTC
CTCTGGCCTGGGGTCGAGGGCCCCGACAGCCCCGACAGCCCCAAGCCTGGGGCTCTGCACCCAGCGGCCC
ACGCGAGATCAGCCTCCCACTTTTCCCTGGAGCACCCCACGGACAGGCAGCTGTTTGACACCATATCCCT
GCTGATCCAGGGCTCCCTGGAGTGGGAGCTGAAGCTGATGGACGAGCTGGCAGGCCCAGGGGGCCAGCCC
TCTGCCTTCCCTTCTGCCCCCAGCCTGGGAGGCTCCGACCCACAGATGCAGCCCCACCCCACGGAGCTGC
CAGGACCAGACTTACTGACTGTGCGGAAGTCTGGGGTCAGCCGAACGCACTCTCTGCCCAATGACAGCTA
CATGTGTCGGCATGGGAGCACTGCCGAGGGGCCCCTGGGACACAGGGGCTGGGGGCTCCCCAAAGCTCAG
TCAGGCTCCGTCTTGTCCGTTCACTCCCAGCCAGCAGATACCAGCTACATCCTGCAGCTTCCCAAAGATG
CACCTCATCTGCTCCAGCCCCACAGCGCCCCAACCTGGGGCACCATCCCCAAACTGCCCCCACCAGGACG
CTCCCCTTTGGCTCAGAGGCCACTCAGGCGCCAGGCAGCAATAAGGACTGACTCCTTGGACGTTCAGGGT
CTGGGCAGCCGGGAAGACCTGCTGGCAGAGGTGAGTGGGCCCTCCCCGCCCCTGGCCCGGGCCTACTCTT
TCTGGGGCCAGTCAAGTACCCAGGCACAGCAGCACTCCCGCAGCCACAGCAAGATCTCCAAGCACATGAC
CCCGCCAGCCCCTTGCCCAGGCCCAGAACCCAACTGGGGCAAGGGCCCTCCAGAGACCAGAAGCAGCTTA
GAGTTGGACACGGAGCTGAGCTGGATTTCAGGAGACCTCCTGCCCCCTGGCGGCCAGGAGGAGCCCCCAT
CCCCACGGGACCTGAAGAAGTGCTACAGCGTGGAGGCCCAGAGCTGCCAGCGCCGGCCTACGTCCTGGCT
GGATGAGCAGAGGAGACACTCTATCGCCGTCAGCTGCCTGGACAGCGGCTCCCAACCCCACCTGGGCACA
GACCCCTCTAACCTTGGGGGCCAGCCTCTTGGGGGGCCTGGGAGCCGGCCCAAGAAAAAACTCAGCCCGC
CTAGTATCACCATAGACCCCCCCGAGAGCCAAGGTCCTCGGACCCCGCCCAGCCCTGGTATCTGCCTCCG
GAGGAGGGCTCCGTCCAGCGACTCCAAGGATCCCTTGGCCTCTGGCCCCCCTGACAGCATGGCTGCCTCG
CCCTCCCCAAAGAAAGATGTGCTGAGTCTCTCCGGTTTATCCTCTGACCCAGCAGACCTGGACCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG219695 representing NM_198385
Red=Cloning site Green=Tags(s)

MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVVFFYLSQDSRP
RSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAFDDFIFAFFAVEMVVKMVALG
IFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVRTVRVLRPLRAINRVPSMRILVTLLLDTLPM
LGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMR
SCRSVPTLRGDGGGGPPCGLDYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQV
ITLEGWVDIMYFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSSSCSRSHRRLS
VHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGAESVHSFYHAD
CHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLTSLNIPPGPYS
SMHKLLETQSTGACQSSCKISSPCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDA
QHSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEE
LTNALEISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTLPDRKNFDSLL
WAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLVAILVEGFQAEEISKREDASG
QLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGDRKKCLALVSLGEHPELRKSLLPPLIIHTAATPMSL
PKSTSTGLGEALGPASRRTSSSGSAEPGAAHEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLK
RRSPSGERRSLLSGEGQESQDEEESSEEERASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGR
GSASEHQDCNGKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFP
PQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAVFLAEMTVKVV
ALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVLRLLRTLRPLRVISRAQGLKL
VVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRWVRHKYNFD
NLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENF
HKCRQHQEEEEARRREEKRLRRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTS
HYLDLFITGVIGLNVVTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDL
AIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLLF
MLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMKDTLRDCDQEST
CYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELEAELELEMKTLSPQPHSPLGSPF
LWPGVEGPDSPDSPKPGALHPAAHARSASHFSLEHPTDRQLFDTISLLIQGSLEWELKLMDELAGPGGQP
SAFPSAPSLGGSDPQMQPHPTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQ
SGSVLSVHSQPADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQG
LGSREDLLAEVSGPSPPLARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGPEPNWGKGPPETRSSL
ELDTELSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGT
DPSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDSKDPLASGPPDSMAAS
PSPKKDVLSLSGLSSDPADLDP

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_198385
ORF Size 6996 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_198385.2, NP_938199
RefSeq Size 8129
RefSeq ORF 6999
Locus ID 8913
Cytogenetics 17q21.33
Protein Families Ion Channels: Calcium, Transmembrane, Druggable Genome
Protein Pathways MAPK signaling pathway, Calcium signaling pathway, Type II diabetes mellitus
Gene Summary Voltage-sensitive calcium channels mediate the entry of calcium ions into excitable cells, and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division, and cell death. This gene encodes a T-type, low-voltage activated calcium channel. The T-type channels generate currents that are both transient, owing to fast inactivation, and tiny, owing to small conductance. T-type channels are thought to be involved in pacemaker activity, low-threshold calcium spikes, neuronal oscillations and resonance, and rebound burst firing. Many alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Sep 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)