SHOX2 (NM_006884) Human Tagged ORF Clone

CAT#: RG219520

SHOX2 (GFP-tagged) - Human short stature homeobox 2 (SHOX2), transcript variant 2

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 546.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name SHOX2 (NM_006884) Human Tagged ORF Clone
Symbol SHOX2
Synonyms OG12; OG12X; SHOT
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG219520 representing NM_006884
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGAACTTACGGCGTTCGTCTCCAAGTCTTTTGACCAGAAAGTGAAGGAGAAGAAGGAGGCGATCA
CGTACCGGGAGGTGCTGGAGAGCGGGCCGCTGCGCGGGGCCAAGGAGCCGACCGGCTGCACCGAGGCGGG
CCGCGACGACCGCAGCAGCCCGGCAGTCCGGGCGGCCGGCGGAGGCGGCGGCGGAGGAGGCGGAGGCGGC
GGCGGAGGAGGCGGAGGAGGTGTAGGAGGAGGTGGAGCAGGCGGAGGAGCTGGAGGAGGGCGCTCTCCCG
TCCGGGAGCTGGACATGGGCGCCGCCGAGAGAAGCAGGGAGCCCGGCAGCCCGCGGCTGACGGAGGTGTC
CCCGGAGCTGAAAGATCGCAAAGACGATGCGAAAGGGATGGAGGACGAAGGCCAGACCAAAATCAAGCAG
AGGCGAAGTCGGACCAATTTCACCCTGGAACAACTCAATGAGCTGGAGAGGCTTTTTGACGAGACCCACT
ATCCCGACGCCTTCATGCGAGAGGAACTGAGCCAGCGACTGGGCCTGTCGGAGGCCCGAGTGCAGGTTTG
GTTTCAAAATCGAAGAGCTAAATGTAGAAAACAAGAAAATCAACTCCATAAAGGTGTTCTCATAGGGGCC
GCCAGCCAGTTTGAAGCTTGTAGAGTCGCACCTTATGTCAACGTAGGTGCTTTAAGGATGCCATTTCAGC
AGGATAGTCATTGCAACGTGACGCCCTTGCCCTTTCAGGTTCAGGCGCAGCTGCAGCTGGACAGCGCTGT
GGCGCACGCGCACCACCACCTGCATCCGCACCTGGCCGCGCACGCGCCCTACATGATGTTCCCAGCACCG
CCCTTCGGACTGCCGCTCGCCACGCTGGCCGCGGATTCGGCTTCCGCCGCCTCGGTAGTGGCGGCCGCAG
CAGCCGCCAAGACCACCAGCAAGGACTCCAGCATCGCCGATCTCAGACTGAAAGCCAAAAAGCACGCCGC
AGCCCTGGGTCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG219520 representing NM_006884
Red=Cloning site Green=Tags(s)

MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPTGCTEAGRDDRSSPAVRAAGGGGGGGGGGG
GGGGGGGVGGGGAGGGAGGGRSPVRELDMGAAERSREPGSPRLTEVSPELKDRKDDAKGMEDEGQTKIKQ
RRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGA
ASQFEACRVAPYVNVGALRMPFQQDSHCNVTPLPFQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAP
PFGLPLATLAADSASAASVVAAAAAAKTTSKDSSIADLRLKAKKHAAALGL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_006884
ORF Size 993 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006884.1, NP_006875
RefSeq Size 1948
RefSeq ORF 996
Locus ID 6474
Cytogenetics 3q25.32
Protein Families Transcription Factors
Gene Summary This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeobox genes. This locus represents a pseudoautosomal homeobox gene that is thought to be responsible for idiopathic short stature, and it is implicated in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations