NLRP8 (NM_176811) Human Tagged ORF Clone

CAT#: RG218775

Reviews ()
Write a review
  • TrueORF®

NLRP8 (GFP-tagged) - Human NLR family, pyrin domain containing 8 (NLRP8)



  "NM_176811" in other vectors (6)

Reconstitution Protocol

USD 1,112.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Other products for "NLRP8"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol NLRP8
Synonyms CLR19.2; NALP8; NOD16; PAN4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG218775 representing NM_176811
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGACGTGAATCCACCCTCTGACACCCCCATTCCCTTTTCATCCTCCTCCACTCACAGTTCTCATA
TTCCGCCCTGGACATTCTCTTGCTACCCCGGCTCCCCATGTGAAAATGGGGTCATGCTGTACATGAGAAA
CGTGAGCCATGAGGAGCTACAACGGTTCAAGCAGCTCTTACTGACTGAGCTCAGTACTGGCACCATGCCC
ATCACCTGGGACCAGGTCGAGACAGCCAGCTGGGCAGAGGTGGTTCATCTCTTGATAGAGCGTTTCCCTG
GACGACGCGCTTGGGATGTGACTTCGAACATCTTTGCCATTATGAACTGTGATAAAATGTGTGTTGTAGT
CCGCAGAGAGATAAATGCCATTCTGCCTACCTTGGAACCAGAGGACTTGAATGTGGGAGAAACACAGGTG
AATCTGGAGGAAGGAGAATCTGGTAAAATACGGCGGTATAAATCGAATGTGATGGAAAAGTTTTTCCCCA
TATGGGACATTACGACTTGGCCTGGAAACCAGAGGGACTTCTTCTACCAAGGTGTACACAGGCACGAGGA
GTACTTACCATGTCTGCTTCTGCCCAAAAGACCCCAGGGTAGACAGCCCAAGACCGTGGCCATACAGGGA
GCTCCTGGGATCGGAAAAACAATCCTGGCCAAAAAGGTGATGTTTGAGTGGGCCAGAAACAAGTTCTACG
CCCACAAGCGCTGGTGTGCTTTCTACTTCCATTGCCAAGAGGTGAACCAGACGACAGACCAGAGCTTCTC
CGAGCTGATTGAGCAAAAGTGGCCTGGATCTCAGGACCTCGTGTCAAAGATTATGTCCAAACCCGACCAA
CTTCTGCTGCTCTTGGATGGCTTTGAGGAGCTCACATCTACCCTCATTGACAGACTGGAGGACCTGAGTG
AAGACTGGAGGCAGAAATTGCCTGGGTCTGTCCTACTGAGCAGTTTGCTGAGCAAAACGATGCTTCCAGA
GGCCACGCTACTGATCATGATAAGATTTACCTCTTGGCAGACATGCAAGCCCTTGCTGAAATGTCCCTCT
CTCGTAACCCTTCCGGGGTTTAATACGATGGAAAAAATCAAGTATTTCCAGATGTATTTTGGACACACAG
AGGAGGGAGACCAAGTCTTGAGTTTCGCCATGGAAAACACCATTCTCTTCTCCATGTGCCGGGTCCCTGT
GGTTTGCTGGATGGTCTGCTCTGGTCTGAAACAGCAAATGGAGAGAGGAAACAATCTCACACAGTCATGT
CCAAATGCCACCTCTGTGTTCGTCCGGTATATTTCTAGCTTGTTTCCCACCAGAGCTGAGAACTTTTCCA
GAAAGATCCACCAAGCACAACTGGAAGGTCTGTGTCACTTGGCCGCAGACAGCATGTGGCACAGGAAATG
GGTGTTAGGTAAAGAAGATCTTGAGGAAGCCAAGCTGGATCAGACGGGAGTCACCGCCTTCCTTGGCATG
AGTATTCTTCGGAGAATTGCAGGTGAGGAAGACCACTATGTCTTTACCCTCGTGACTTTTCAGGAATTTT
TTGCGGCCTTGTTTTATGTTCTCTGTTTCCCACAAAGACTCAAAAATTTTCATGTGTTGAGCCACGTGAA
TATCCAGCGCCTGATAGCGAGTCCCAGAGGAAGCAAAAGCTATCTCTCTCACATGGGACTTTTCTTATTC
GGTTTTCTGAACGAGGCCTGCGCTTCGGCCGTGGAACAGTCATTCCAATGCAAGGTGTCTTTCGGTAATA
AGAGGAAACTGCTGAAAGTCATACCTCTGTTGCATAAATGTGACCCACCTTCTCCGGGCAGTGGGGTCCC
GCAGTTATTCTACTGTCTGCATGAAATCCGGGAGGAAGCCTTTGTAAGCCAAGCCCTAAATGATTATCAT
AAAGTTGTCTTGAGAATTGGCAACAACAAAGAAGTTCAAGTGTCTGCTTTTTGCCTGAAGCGGTGTCAAT
ATTTGCATGAGGTGGAACTGACCGTCACCCTGAACTTCATGAACGTGTGGAAGCTCAGCTCCAGCTCCCA
TCCTGGCTCTGAAGCGCCAGAGAGCAATGGGCTGCATCGTTGGTGGCAAGACTTATGCTCTGTGTTTGCA
ACGAATGATAAGCTGGAAGTCCTGACTATGACCAACAGTGTTTTGGGGCCTCCTTTTTTGAAGGCTCTCG
CGGCCGCACTGAGGCACCCTCAGTGCAAACTGCAAAAGCTACTCCTAAGGCGTGTGAATAGCACCATGTT
GAACCAGGACTTAATCGGTGTTTTGACGGGGAACCAGCATCTGAGATACTTGGAAATACAACATGTGGAA
GTGGAGTCCAAAGCTGTGAAGCTTCTATGCAGGGTGCTGAGATCCCCCCGGTGCCGTCTGCAGTGTCTCA
GGTTGGAAGACTGCTTGGCCACCCCTAGAATTTGGACTGATCTTGGCAATAATCTTCAAGGTAACGGGCA
TCTAAAGACTCTCATACTAAGAAAAAACTCCCTGGAGAACTGTGGGGCGTATTACCTGTCTGTGGCCCAG
CTGGAGAGGCTGTCGATAGAGAACTGCAACCTTACACAGCTTACTTGTGAAAGCCTTGCCTCCTGTCTCA
GGCAGAGTAAGATGCTGACCCACCTGAGCTTGGCAGAAAACGCCTTGAAAGATGAAGGGGCCAAGCATAT
TTGGAATGCCCTGCCACACCTGAGATGTCCTCTGCAGAGGCTGGTACTGAGAAAGTGTGACTTGACCTTT
AATTGCTGTCAGGATATGATCTCTGCGCTCTGTAAAAATAAAACCCTGAAAAGTCTTGACCTAAGTTTTA
ATAGCCTGAAGGATGATGGGGTGATCCTGCTGTGTGAGGCCCTGAAGAACCCTGACTGTACATTACAGAT
CCTGGAGCTGGAAAACTGCCTGTTCACCTCCATCTGCTGCCAGGCCATGGCTTCCATGCTCCGCAAAAAC
CAACATCTGAGACATCTGGACTTGAGCAAGAATGCGATTGGAGTCTATGGTATTCTGACCTTGTGCGAGG
CCTTCTCAAGCCAAAAGAAGAGAGAAGAGGTCATTTTCTGTATTCCTGCCTGGACTCGAATAACTAGCTT
CTCCCCAACTCCTCACCCACCCGACTTCACGGGAAAAAGTGACTGCCTATCCCAGATTAATCCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG218775 representing NM_176811
Red=Cloning site Green=Tags(s)

MSDVNPPSDTPIPFSSSSTHSSHIPPWTFSCYPGSPCENGVMLYMRNVSHEELQRFKQLLLTELSTGTMP
ITWDQVETASWAEVVHLLIERFPGRRAWDVTSNIFAIMNCDKMCVVVRREINAILPTLEPEDLNVGETQV
NLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQGVHRHEEYLPCLLLPKRPQGRQPKTVAIQG
APGIGKTILAKKVMFEWARNKFYAHKRWCAFYFHCQEVNQTTDQSFSELIEQKWPGSQDLVSKIMSKPDQ
LLLLLDGFEELTSTLIDRLEDLSEDWRQKLPGSVLLSSLLSKTMLPEATLLIMIRFTSWQTCKPLLKCPS
LVTLPGFNTMEKIKYFQMYFGHTEEGDQVLSFAMENTILFSMCRVPVVCWMVCSGLKQQMERGNNLTQSC
PNATSVFVRYISSLFPTRAENFSRKIHQAQLEGLCHLAADSMWHRKWVLGKEDLEEAKLDQTGVTAFLGM
SILRRIAGEEDHYVFTLVTFQEFFAALFYVLCFPQRLKNFHVLSHVNIQRLIASPRGSKSYLSHMGLFLF
GFLNEACASAVEQSFQCKVSFGNKRKLLKVIPLLHKCDPPSPGSGVPQLFYCLHEIREEAFVSQALNDYH
KVVLRIGNNKEVQVSAFCLKRCQYLHEVELTVTLNFMNVWKLSSSSHPGSEAPESNGLHRWWQDLCSVFA
TNDKLEVLTMTNSVLGPPFLKALAAALRHPQCKLQKLLLRRVNSTMLNQDLIGVLTGNQHLRYLEIQHVE
VESKAVKLLCRVLRSPRCRLQCLRLEDCLATPRIWTDLGNNLQGNGHLKTLILRKNSLENCGAYYLSVAQ
LERLSIENCNLTQLTCESLASCLRQSKMLTHLSLAENALKDEGAKHIWNALPHLRCPLQRLVLRKCDLTF
NCCQDMISALCKNKTLKSLDLSFNSLKDDGVILLCEALKNPDCTLQILELENCLFTSICCQAMASMLRKN
QHLRHLDLSKNAIGVYGILTLCEAFSSQKKREEVIFCIPAWTRITSFSPTPHPPDFTGKSDCLSQINP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_176811
ORF Size 3144 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_176811.2, NP_789781.2
RefSeq Size 3934 bp
RefSeq ORF 3147 bp
Locus ID 126205
UniProt ID Q86W28
Cytogenetics 19q13.43
Gene Summary This gene encodes a member of the nucleotide-binding oligomerization domain/ leucine rich repeat/ pyrin domain containing (NLRP) subfamily, which belongs to the Nod-like receptor family of proteins. NLRP genes play roles in the mammalian innate immune system through inflammasome formation and activation of caspases. In addition, NLRP genes have been found to function during mammalian reproduction. Consistent with a function during human preimplantation development, this gene is expressed at high levels in oocytes with decreased levels in embryos. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]

Other Versions

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.