HOXB5 (NM_002147) Human Tagged ORF Clone

CAT#: RG218740

HOXB5 (GFP-tagged) - Human homeobox B5 (HOXB5)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 546.00


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HOXB5 (NM_002147) Human Tagged ORF Clone
Symbol HOXB5
Synonyms HHO.C10; HOX2; Hox2.1; HOX2A; HU-1
Vector pCMV6-AC-GFP
Sequence Data
>RG218740 representing NM_002147
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTCGTACTTTGTAAACTCCTTCTCGGGGCGTTATCCAAATGGCCCGGACTATCAGTTGCTAAATT
ATGGCAGTGGCAGCTCTCTGAGCGGCTCTTACAGGGATCCCGCTGCCATGCACACCGGCTCTTACGGCTA
CAATTACAATGGGATGGACCTCAGCGTCAACCGCTCCTCGGCCTCCTCCAGCCACTTTGGGGCGGTGGGC
GAGAGCTCGCGCGCCTTCCCCGCGCCCGCCCAGGAGCCCCGCTTCAGGCAAGCGGCTTCGAGCTGCTCCC
TGTCCTCGCCCGAGTCCCTGCCCTGCACCAACGGCGACAGCCACGGCGCCAAGCCCTCTGCTTCGTCCCC
CTCCGACCAGGCGACCTCAGCCAGCTCCAGCGCCAATTTCACCGAAATAGACGAGGCCAGCGCGTCCTCG
GAGCCTGAGGAAGCGGCAAGCCAGCTAAGCAGCCCCAGCCTAGCTCGGGCGCAGCCAGAGCCCATGGCCA
CCTCCACAGCCGCGCCCGAGGGGCAGACTCCGCAGATATTCCCCTGGATGAGGAAGCTTCACATCAGCCA
TGATATGACCGGGCCGGACGGGAAAAGGGCCCGGACCGCGTATACCCGCTACCAGACCCTGGAGCTGGAA
AAGGAGTTCCACTTCAACCGCTACCTGACCCGGCGACGGCGCATCGAGATCGCCCACGCACTCTGCCTGT
CCGAGCGCCAGATCAAGATCTGGTTCCAGAACCGGCGCATGAAGTGGAAGAAGGACAACAAATTGAAAAG
TATGAGCCTGGCTACAGCTGGCAGCGCCTTCCAGCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG218740 representing NM_002147
Red=Cloning site Green=Tags(s)

MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVG
ESSRAFPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASS
EPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELE
KEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAFQP

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_002147
ORF Size 807 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002147.2, NP_002138
RefSeq Size 1835
RefSeq ORF 810
Locus ID 3215
Cytogenetics 17q21.32
Domains homeobox
Protein Families Transcription Factors
Gene Summary This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)