ATAD2 (NM_014109) Human Tagged ORF Clone

CAT#: RG218291

Reviews ()
Write a review
  • TrueORF®

ATAD2 (GFP-tagged) - Human ATPase family, AAA domain containing 2 (ATAD2)



  "NM_014109" in other vectors (6)

USD 660.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ATAD2 (NM_014109) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ATAD2
Synonyms ANCCA; CT137; PRO2000
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG218291 representing NM_014109
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGTTCTCCGCAGCAGCTTGGAGCTGCACAACCACTCCGCGGCCTCGGCCACGGGCTCCTTGGACC
TGTCCAGTGACTTCCTCAGTCTGGAGCACATCGGCCGGAGGCGGCTCCGCTCGGCCGGCGCGGCGCAGAA
GAAACCCGCGGCGACCACAGCCAAAGCGGGCGATGGGTCATCAGTTAAGGAAGTTGAAACCTACCACCGG
ACACGTGCTTTAAGATCTTTGAGAAAAGATGCACAGAATTCTTCAGATTCTAGTTTTGAGAAGAATGTGG
AAATAACGGAGCAACTTGCTAATGGCAGGCATTTTACAAGGCAGTTGGCCAGACAGCAGGCTGATAAAAA
AAAAGAAGAGCACAGAGAAGACAAAGTGATTCCAGTTACTCGGTCATTGAGGGCTAGAAACATCGTTCAA
AGTACAGAACACTTACATGAAGATAATGGTGATGTTGAAGTGCGTCGAAGTTGTAGGATTAGAAGTCGTT
ATAGTGGTGTAAACCAGTCCATGCTGTTTGACAAACTTATAACTAACACTGCTGAAGCTGTACTTCAAAA
AATGGATGACATGAAGAAGATGCGTAGACAGCGAATGAGAGAACTTGAAGACTTGGGAGTGTTTAATGAA
ACAGAAGAAAGCAATCTTAATATGTACACAAGAGGAAAACAGAAAGATATTCAAAGAACTGATGAAGAAA
CAACTGATAATCAAGAAGGCAGTGTGGAGTCATCTGAAGAGGGTGAAGACCAAGAACATGAAGATGATGG
TGAAGATGAAGATGATGAAGATGATGATGATGATGACGATGATGATGATGATGATGATGATGAAGATGAT
GAAGATGAAGAAGATGGAGAAGAAGAGAATCAGAAGCGATATTATCTTAGACAGAGAAAAGCTACTGTTT
ACTATCAGGCTCCATTGGAAAAACCTCGTCACCAGAGAAAGCCCAACATATTTTATAGTGGCCCAGCTTC
TCCTGCAAGACCAAGATACCGATTATCTTCCGCAGGACCAAGAAGTCCTTACTGTAAACGAATGAACAGG
CGAAGGCATGCAATCCACAGTAGTGACTCGACTTCATCTTCCTCCTCTGAAGATGAACAGCACTTTGAGA
GGCGGAGGAAAAGGAGTCGTAATAGGGCTATCAATAGGTGCCTCCCACTAAATTTTCGGAAAGATGAATT
AAAAGGCATTTATAAAGATCGAATGAAAATTGGAGCAAGCCTTGCCGATGTTGATCCAATGCAACTAGAT
TCTTCAGTACGATTTGATAGTGTTGGTGGCCTGTCTAATCATATAGCAGCTCTAAAAGAGATGGTGGTGT
TTCCATTACTTTATCCAGAAGTCTTTGAAAAATTTAAAATTCAACCCCCAAGAGGTTGTTTGTTTTATGG
GCCACCTGGAACTGGAAAGACTCTGGTTGCCAGAGCACTTGCCAATGAGTGCAGTCAAGGGGATAAAAGA
GTAGCATTTTTCATGAGGAAAGGTGCTGATTGTCTAAGTAAATGGGTAGGAGAATCTGAAAGACAGCTAC
GATTGCTGTTTGATCAGGCCTATCAGATGCGCCCATCAATTATTTTTTTTGACGAAATTGATGGTCTGGC
TCCAGTACGGTCAAGCAGGCAAGATCAGATTCACAGTTCTATTGTTTCCACCCTGCTAGCTCTTATGGAT
GGATTGGACAGCAGAGGGGAAATTGTGGTCATTGGTGCTACGAACAGGCTAGATTCTATAGATCCTGCTT
TACGAAGGCCTGGTCGCTTTGATAGAGAATTCCTCTTTAGCCTGCCTGATAAAGAGGCTCGAAAAGAGAT
TCTAAAGATTCACACCAGGGATTGGAATCCCAAACCACTGGACACATTTTTAGAAGAGCTAGCAGAAAAC
TGTGTTGGATACTGTGGAGCAGATATTAAATCAATATGTGCTGAAGCTGCTTTATGTGCTTTACGACGAC
GCTACCCACAGATCTATACCACTAGTGAGAAACTGCAGTTGGATCTCTCTTCAATTAATATCTCAGCTAA
GGATTTCGAGGTAGCTATGCAAAAGATGATACCAGCCTCCCAAAGAGCTGTGACATCACCTGGGCAGGCA
CTGTCCACCGTTGTGAAACCACTCCTGCAAAACACTGTTGACAAGATTTTAGAAGCCCTGCAGAGAGTAT
TTCCACATGCAGAATTCAGAACAAATAAAACATTAGACTCAGATATTTCTTGTCCTCTGCTAGAAAGTGA
CTTGGCTTACAGTGATGATGATGTTCCATCAGTTTATGAAAATGGACTTTCTCAGAAATCTTCTCATAAG
GCAAAAGACAATTTTAATTTTCTTCATTTGAATAGAAATGCTTGTTACCAACCTATGTCTTTTCGACCAA
GAATATTGATAGTAGGAGAACCAGGATTTGGGCAAGGTTCTCACTTGGCACCAGCTGTCATTCATGCTTT
GGAAAAGTTTACTGTATATACATTAGACATTCCTGTTCTTTTTGGAGTTAGTACTACATCCCCTGAAGAA
ACATGTGCCCAGGTGATTCGTGAAGCTAAGAGAACAGCACCAAGTATAGTGTATGTTCCTCATATCCACG
TGTGGTGGGAAATAGTTGGACCGACACTTAAAGCCACATTTACCACATTATTACAGAATATTCCTTCATT
TGCTCCAGTTTTACTACTTGCAACTTCTGACAAACCCCATTCCGCTTTGCCAGAAGAGGTGCAAGAATTG
TTTATCCGTGATTATGGAGAGATTTTTAATGTCCAGTTACCGGATAAAGAAGAACGGACAAAATTTTTTG
AAGATTTAATTCTAAAACAAGCTGCTAAGCCTCCTATATCAAAAAAGAAAGCAGTTTTGCAGGCTTTGGA
GGTACTCCCAGTAGCACCACCACCTGAGCCAAGATCACTGACAGCAGAAGAAGTGAAACGACTAGAAGAA
CAAGAAGAAGATACATTTAGAGAACTGAGGATTTTCTTAAGAAATGTTACACATAGGCTTGCTATTGACA
AGCGATTCCGAGTGTTTACTAAGCCTGTTGACCCTGATGAGGTTCCTGATTATGTCACTGTAATAAAGCA
ACCAATGGACCTTTCATCTGTAATCAGTAAAATTGATCTACACAAGTATCTGACTGTGAAAGACTATTTG
AGAGATATTGATCTAATCTGTAGTAATGCCTTAGAATACAATCCAGATAGAGATCCTGGAGATCGTCTTA
TTAGGCATAGAGCCTGTGCTTTAAGAGATACTGCCTATGCCATAATTAAAGAAGAACTTGATGAAGACTT
TGAGCAGCTCTGTGAAGAAATTCAGGAATCTAGAAAGAAAAGAGGTTGTAGCTCCTCCAAATATGCCCCG
TCTTACTACCATGTGATGCCAAAGCAAAATTCCACTCTTGTTGGTGATAAAAGATCAGACCCAGAGCAGA
ATGAAAAGCTAAAGACACCGAGTACTCCTGTGGCTTGCAGCACTCCTGCTCAGTTGAAGAGGAAAATTCG
CAAAAAGTCAAACTGGTACTTAGGCACCATAAAAAAGCGAAGGAAGATTTCACAGGCAAAGGATGATAGC
CAGAATGCCATAGATCACAAAATTGAGAGTGATACAGAGGAAACTCAAGACACAAGTGTAGATCATAATG
AGACCGGAAACACAGGAGAGTCTTCGGTGGAAGAAAATGAAAAACAGCAAAATGCCTCTGAAAGCAAACT
GGAATTGAGAAATAATTCAAATACTTGTAATATAGAGAATGAGCTTGAAGACTCTAGGAAGACTACAGCA
TGTACAGAATTGAGAGACAAGATTGCTTGTAATGGAGATGCTTCTAGCTCTCAGATAATACATATTTCTG
ATGAAAATGAAGGAAAAGAAATGTGTGTTCTGCGAATGACTCGAGCTAGACGTTCCCAGGTAGAACAGCA
GCAGCTCATCACTGTTGAAAAGGCTTTGGCAATTCTTTCTCAGCCTACACCCTCACTTGTTGTGGATCAT
GAGCGATTAAAAAATCTTTTGAAGACTGTTGTTAAAAAAAGTCAAAACTACAACATATTTCAGTTGGAAA
ATTTGTATGCAGTAATCAGCCAATGTATTTATCGGCATCGCAAGGACCATGATAAAACATCACTTATTCA
GAAAATGGAGCAAGAGGTAGAAAACTTCAGTTGTTCCAGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG218291 representing NM_014109
Red=Cloning site Green=Tags(s)

MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGSSVKEVETYHR
TRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEEHREDKVIPVTRSLRARNIVQ
STEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITNTAEAVLQKMDDMKKMRRQRMRELEDLGVFNE
TEESNLNMYTRGKQKDIQRTDEETTDNQEGSVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDD
EDEEDGEEENQKRYYLRQRKATVYYQAPLEKPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNR
RRHAIHSSDSTSSSSSEDEQHFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD
SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDKR
VAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMD
GLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIHTRDWNPKPLDTFLEELAEN
CVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQA
LSTVVKPLLQNTVDKILEALQRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHK
AKDNFNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEE
TCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPHSALPEEVQEL
FIRDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLPVAPPPEPRSLTAEEVKRLEE
QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYL
RDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP
SYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDS
QNAIDHKIESDTEETQDTSVDHNETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTA
CTELRDKIACNGDASSSQIIHISDENEGKEMCVLRMTRARRSQVEQQQLITVEKALAILSQPTPSLVVDH
ERLKNLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQKMEQEVENFSCSR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_014109
ORF Size 4170 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014109.2, NP_054828.2
RefSeq Size 4916 bp
RefSeq ORF 4173 bp
Locus ID 29028
Cytogenetics 8q24.13
Domains BROMO, AAA, AAA
Protein Families Druggable Genome
Gene Summary A large family of ATPases has been described, whose key feature is that they share a conserved region of about 220 amino acids that contains an ATP-binding site. The proteins that belong to this family either contain one or two AAA (ATPases Associated with diverse cellular Activities) domains. AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes. The protein encoded by this gene contains two AAA domains, as well as a bromodomain. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "ATAD2"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools