5 Lipoxygenase(ALOX5) (NM_000698) Human Tagged ORF Clone

CAT#: RG217259

ALOX5 (GFP-tagged) - Human arachidonate 5-lipoxygenase (ALOX5)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name 5 Lipoxygenase(ALOX5) (NM_000698) Human Tagged ORF Clone
Symbol ALOX5
Synonyms 5-LO; 5-LOX; 5LPG; LOG5
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG217259 representing NM_000698
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCTCCTACACGGTCACCGTGGCCACTGGCAGCCAGTGGTTCGCCGGCACTGACGACTACATCTACC
TCAGCCTCGTGGGCTCGGCGGGCTGCAGCGAGAAGCACCTGCTGGACAAGCCCTTCTACAACGACTTCGA
GCGTGGCGCGGTGGATTCATACGACGTGACTGTGGACGAGGAACTGGGCGAGATCCAGCTGGTCAGAATC
GAGAAGCGCAAGTACTGGCTGAATGACGACTGGTACCTGAAGTACATCACGCTGAAGACGCCCCACGGGG
ACTACATCGAGTTCCCCTGCTACCGCTGGATCACCGGCGATGTCGAGGTTGTCCTGAGGGATGGACGCGC
AAAGTTGGCCCGAGATGACCAAATTCACATTCTCAAGCAACACCGACGTAAAGAACTGGAAACACGGCAA
AAACAATATCGATGGATGGAGTGGAACCCTGGCTTCCCCTTGAGCATCGATGCCAAATGCCACAAGGATT
TACCCCGTGATATCCAGTTTGATAGTGAAAAAGGAGTGGACTTTGTTCTGAATTACTCCAAAGCGATGGA
GAACCTGTTCATCAACCGCTTCATGCACATGTTCCAGTCTTCTTGGAATGACTTCGCCGACTTTGAGAAA
ATCTTTGTCAAGATCAGCAACACTATTTCTGAGCGGGTCATGAATCACTGGCAGGAAGACCTGATGTTTG
GCTACCAGTTCCTGAATGGCTGCAACCCTGTGTTGATCCGGCGCTGCACAGAGCTGCCCGAGAAGCTCCC
GGTGACCACGGAGATGGTAGAGTGCAGCCTGGAGCGGCAGCTCAGCTTGGAGCAGGAGGTCCAGCAAGGG
AACATTTTCATCGTGGACTTTGAGCTGCTGGATGGCATCGATGCCAACAAAACAGACCCCTGCACACTCC
AGTTCCTGGCCGCTCCCATCTGCTTGCTGTATAAGAACCTGGCCAACAAGATTGTCCCCATTGCCATCCA
GCTCAACCAAATCCCGGGAGATGAGAACCCTATTTTCCTCCCTTCGGATGCAAAATACGACTGGCTTTTG
GCCAAAATCTGGGTGCGTTCCAGTGACTTCCACGTCCACCAGACCATCACCCACCTTCTGCGAACACATC
TGGTGTCTGAGGTTTTTGGCATTGCAATGTACCGCCAGCTGCCTGCTGTGCACCCCATTTTCAAGCTGCT
GGTGGCACACGTGAGATTCACCATTGCAATCAACACCAAGGCCCGTGAGCAGCTCATCTGCGAGTGTGGC
CTCTTTGACAAGGCCAACGCCACAGGGGGCGGTGGGCACGTGCAGATGGTGCAGAGGGCCATGAAGGACC
TGACCTATGCCTCCCTGTGCTTTCCCGAGGCCATCAAGGCCCGGGGCATGGAGAGCAAAGAAGACATCCC
CTACTACTTCTACCGGGACGACGGGCTCCTGGTGTGGGAAGCCATCAGGACGTTCACGGCCGAGGTGGTA
GACATCTACTACGAGGGCGACCAGGTGGTGGAGGAGGACCCGGAGCTGCAGGACTTCGTGAACGATGTCT
ACGTGTACGGCATGCGGGGCCGCAAGTCCTCAGGCTTCCCCAAGTCGGTCAAGAGCCGGGAGCAGCTGTC
GGAGTACCTGACCGTGGTGATCTTCACCGCCTCCGCCCAGCACGCCGCGGTCAACTTCGGCCAGTACGAC
TGGTGCTCCTGGATCCCCAATGCGCCCCCAACCATGCGAGCCCCGCCGCCGACTGCCAAGGGCGTGGTGA
CCATTGAGCAGATCGTGGACACGCTGCCCGACCGCGGCCGCTCCTGCTGGCATCTGGGTGCAGTGTGGGC
GCTGAGCCAGTTCCAGGAAAACGAGCTGTTCCTGGGCATGTACCCAGAAGAGCATTTTATCGAGAAGCCT
GTGAAGGAAGCCATGGCCCGATTCCGCAAGAACCTCGAGGCCATTGTCAGCGTGATTGCTGAGCGCAACA
AGAAGAAGCAGCTGCCATATTACTACTTGTCCCCAGACCGGATTCCGAACAGTGTGGCCATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG217259 representing NM_000698
Red=Cloning site Green=Tags(s)

MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRI
EKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQ
KQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEK
IFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQG
NIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLL
AKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVV
DIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYD
WCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKP
VKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000698
ORF Size 2022 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000698.2, NP_000689
RefSeq Size 2568
RefSeq ORF 2025
Locus ID 240
Cytogenetics 10q11.21
Domains lipoxygenase, LH2
Protein Families Druggable Genome
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
Gene Summary This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations