C19orf12 (NM_001031726) Human Tagged ORF Clone

CAT#: RG216851

C19orf12 (GFP-tagged) - Human chromosome 19 open reading frame 12 (C19orf12), transcript variant 1

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name C19orf12 (NM_001031726) Human Tagged ORF Clone
Symbol C19orf12
Synonyms NBIA3; NBIA4; SPG43
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG216851 representing NM_001031726
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGGCTGAAGTCACACAAGCCCGCCACGATGACTATCATGGTGGAGGACATCATGAAGCTGCTGT
GCTCCCTTTCTGGGGAGAGGAAGATGAAGGCGGCTGTCAAGCACTCTGGGAAGGGTGCCCTGGTCACAGG
GGCCATGGCCTTCGTCGGGGGTTTGGTGGGCGGCCCACCGGGACTCGCCGTTGGGGGGGCTGTCGGGGGG
CTGTTAGGTGCCTGGATGACAAGTGGACAGTTTAAGCCGGTTCCTCAGATCCTAATGGAGCTGCCCCCTG
CCGAGCAACAGAGGCTCTTTAACGAAGCCGCAGCCATCATCAGGCACCTGGAGTGGACGGACGCCGTGCA
GCTGACCGCGCTGGTCATGGGCAGCGAGGCCCTGCAGCAGCAGCTGCTGGCCATGCTGGTGAACTACGTC
ACCAAGGAGCTGCGGGCCGAGATCCAGTATGATGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG216851 representing NM_001031726
Red=Cloning site Green=Tags(s)

MERLKSHKPATMTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGG
LLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYV
TKELRAEIQYDD

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001031726
ORF Size 456 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001031726.2, NP_001026896
RefSeq Size 4431
RefSeq ORF 459
Locus ID 83636
Cytogenetics 19q12
Protein Families Transmembrane
Gene Summary This gene encodes a small transmembrane protein. Mutations in this gene are a cause of neurodegeneration with brain iron accumulation-4 (NBIA4), but the specific function of the encoded protein is unknown. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations