FOXP1 (NM_001012505) Human Tagged ORF Clone

CAT#: RG216342

FOXP1 (GFP-tagged) - Human forkhead box P1 (FOXP1), transcript variant 2

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name FOXP1 (NM_001012505) Human Tagged ORF Clone
Symbol FOXP1
Synonyms 12CC4; hFKH1B; HSPC215; MFH; QRF1
Vector pCMV6-AC-GFP
Sequence Data
>RG216342 representing NM_001012505
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCA
ACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGG
GGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGTGGCATCTCATAAACCATCAGCCCTCTAGG
AGTCCCAGCAGTTGGCTTAAGAGACTAATTTCAAGCCCTTGGGAGTTGGAAGTCCTGCAGGTCCCCTTGT
GGGGAGCAGTTGCTGAGACGAAGATGAGTGGACCTGTGTGTCAGCCTAACCCTTCCCCATTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG216342 representing NM_001012505
Red=Cloning site Green=Tags(s)

MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSR
SPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001012505
ORF Size 342 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001012505.1, NP_001012523
RefSeq Size 937
RefSeq ORF 345
Locus ID 27086
Cytogenetics 3p13
Protein Families Transcription Factors
Gene Summary This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)