DUSP6 (NM_022652) Human Tagged ORF Clone

CAT#: RG216245

DUSP6 (GFP-tagged) - Human dual specificity phosphatase 6 (DUSP6), transcript variant 2

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name DUSP6 (NM_022652) Human Tagged ORF Clone
Symbol DUSP6
Synonyms HH19; MKP3; PYST1
Vector pCMV6-AC-GFP
Sequence Data
>RG216245 representing NM_022652
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATAGATACGCTCAGACCCGTGCCCTTCGCGTCGGAAATGGCGATCAGCAAGACGGTGGCGTGGCTCA
ACGAGCAGCTGGAGCTGGGCAACGAGCGGCTGCTGCTGATGGACTGCCGGCCGCAGGAGCTATACGAGTC
GTCGCACATCGAGTCGGCCATCAACGTGGCCATCCCGGGCATCATGCTGCGGCGCCTGCAGAAGGGTAAC
CTGCCGGTGCGCGCGCTCTTCACGCGCGGCGAGGACCGGGACCGCTTCACCCGGCGCTGTGGCACCGACA
CAGTGGTGCTCTACGACGAGAGCAGCAGCGACTGGAACGAGAATACGGGCGGCGAGTCGGTGCTCGGGCT
GCTGCTCAAGAAGCTCAAGGACGAGGGCTGCCGGGCGTTCTACCTGGAAGATGAAGCCCGGGGCAAGAAC
TGTGGTGTCTTGGTACATTGCTTGGCTGGCATTAGCCGCTCAGTCACTGTGACTGTGGCTTACCTTATGC
AGAAGCTCAATCTGTCGATGAACGATGCCTATGACATTGTCAAAATGAAAAAATCCAACATATCCCCTAA
CTTCAACTTCATGGGTCAGCTGCTGGACTTCGAGAGGACGCTGGGACTCAGCAGCCCATGTGACAACAGG
GTTCCAGCACAGCAGCTGTATTTTACCACCCCTTCCAACCAGAATGTATACCAGGTGGACTCTCTGCAAT
CTACG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG216245 representing NM_022652
Red=Cloning site Green=Tags(s)

MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGN
LPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEDEARGKN
CGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNR
VPAQQLYFTTPSNQNVYQVDSLQST

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_022652
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_022652.2, NP_073143
RefSeq Size 2404
RefSeq ORF 708
Locus ID 1848
Cytogenetics 12q21.33
Domains DSPc, RHOD
Protein Families Phosphatase, Druggable Genome
Protein Pathways MAPK signaling pathway
Gene Summary The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK2, is expressed in a variety of tissues with the highest levels in heart and pancreas, and unlike most other members of this family, is localized in the cytoplasm. Mutations in this gene have been associated with congenital hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)