PPAR alpha(PPARA) (NM_001001928) Human Tagged ORF Clone

CAT#: RG216237

PPARA (GFP-tagged) - Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3

Change vector?

  • TrueORF®

USD 660.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name PPAR alpha(PPARA) (NM_001001928) Human Tagged ORF Clone
Symbol PPARA
Synonyms hPPAR; NR1C1; PPAR; PPARalpha
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG216237 representing NM_001001928
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTAT
CTGAAGAGTTCCTGCAAGAAATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGG
AAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGTCCTGGCTCAGATGGCTCGGTCATCACGGAC
ACGCTTTCACCAGCTTCGAGCCCCTCCTCGGTGACTTATCCTGTGGTCCCCGGCAGCGTGGACGAGTCTC
CCAGTGGAGCATTGAACATCGAATGTAGAATCTGCGGGGACAAGGCCTCAGGCTATCATTACGGAGTCCA
CGCGTGTGAAGGCTGCAAGGGCTTCTTTCGGCGAACGATTCGACTCAAGCTGGTGTATGACAAGTGCGAC
CGCAGCTGCAAGATCCAGAAAAAGAACAGAAACAAATGCCAGTATTGTCGATTTCACAAGTGCCTTTCTG
TCGGGATGTCACACAACGCGATTCGTTTTGGACGAATGCCAAGATCTGAGAAAGCAAAACTGAAAGCAGA
AATTCTTACCTGTGAACATGACATAGAAGATTCTGAAACTGCAGATCTCAAATCTCTGGCCAAGAGAATC
TACGAGGCCTACTTGAAGAACTTCAACATGAACAAGGTCAAAGCCCGGGTCATCCTCTCAGGAAAGGCCA
GTAACAATCCACCTTTTGTCATACATGATATGGAGACACTGTGTATGGCTGAGAAGACGCTGGTGGCCAA
GCTGGTGGCCAATGGCATCCAGAACAAGGAGGCGGAGGTCCGCATCTTTCACTGCTGCCAGTGCACGTCA
GTGGAGACCGTCACGGAGCTCACGGAATTCGCCAAGGCCATCCCAGGCTTCGCAAACTTGGACCTGAACG
ATCAAGTGACATTGCTAAAATACGGAGTTTATGAGGCCATATTCGCCATGCTGTCTTCTGTGATGAACAA
AGACGGGATGCTGGTAGCGTATGGAAATGGGTTTATAACTCGTGAATTCCTAAAAAGCCTAAGGAAACCG
TTCTGTGATATCATGGAACCCAAGTTTGATTTTGCCATGAAGTTCAATGCACTGGAACTGGATGACAGTG
ATATCTCCCTTTTTGTGGCTGCTATCATTTGCTGTGGAGATCGTCCTGGCCTTCTAAACGTAGGACACAT
TGAAAAAATGCAGGAGGGTATTGTACATGTGCTCAGACTCCACCTGCAGAGCAACCACCCGGACGATATC
TTTCTCTTCCCAAAACTTCTTCAAAAAATGGCAGACCTCCGGCAGCTGGTGACGGAGCATGCGCAGCTGG
TGCAGATCATCAAGAAGACGGAGTCGGATGCTGCGCTGCACCCGCTACTGCAGGAGATCTACAGGGACAT
GTAC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG216237 representing NM_001001928
Red=Cloning site Green=Tags(s)

MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITD
TLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCD
RSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRI
YEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTS
VETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKP
FCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001001928
ORF Size 1404 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001001928.2, NP_001001928
RefSeq Size 9965
Locus ID 5465
Cytogenetics 22q13.31
Protein Families Nuclear Hormone Receptor, Transcription Factors, Druggable Genome
Protein Pathways PPAR signaling pathway, Adipocytokine signaling pathway
Gene Summary Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.