TCF7L2 (NM_030756) Human Tagged ORF Clone

CAT#: RG216058

TCF7L2 (GFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 2

Change vector?

  • TrueORF®

USD 835.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TCF7L2 (NM_030756) Human Tagged ORF Clone
Symbol TCF7L2
Synonyms TCF-4; TCF4
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG216058 representing NM_030756
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCAGCTGAACGGCGGTGGAGGGGATGACCTAGGCGCCAACGACGAACTGATTTCCTTCAAAGACG
AGGGCGAACAGGAGGAGAAGAGCTCCGAAAACTCCTCGGCAGAGAGGGATTTAGCTGATGTCAAATCGTC
TCTAGTCAATGAATCAGAAACGAATCAAAACAGCTCCTCCGATTCCGAGGCGGAAAGACGGCCTCCGCCT
CGCTCCGAAAGTTTCCGAGACAAATCCCGGGAAAGTTTGGAAGAAGCGGCCAAGAGGCAAGATGGAGGGC
TCTTTAAGGGGCCACCGTATCCCGGCTACCCCTTCATCATGATCCCCGACCTGACGAGCCCCTACCTCCC
CAACGGATCGCTCTCGCCCACCGCCCGAACCTATCTCCAGATGAAATGGCCACTGCTTGATGTCCAGGCA
GGGAGCCTCCAGAGTAGACAAGCCCTCAAGGATGCCCGGTCCCCATCACCGGCACACATTGTCTCTAACA
AAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACA
CTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCT
CCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGC
TAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTA
CCCCACAGCTCTGACCGTCAATGCTTCCGTGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACG
CTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTG
ATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACAT
AAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACG
TTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAG
CGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCG
GGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAA
TGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTCAGCGCTCCTAAGAAATGCCGAGCGC
GCTTTGGCCTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACAT
ACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCC
CCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGT
CCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGC
CACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCC
GCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTGGTTACATTCCCACAGCTCCCTGGCCGGGACCC
AGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG216058 representing NM_030756
Red=Cloning site Green=Tags(s)

MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPP
RSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTYLQMKWPLLDVQA
GSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRP
PHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASVSRFPPHMVPPHHT
LHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECT
LKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSE
CFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPS
PNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPA
APSSSIAQPSTSWLHSHSSLAGTQPQPLSLVTKSLE

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_030756
ORF Size 1788 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_030756.1, NP_110383
RefSeq Size 2444
Locus ID 6934
Cytogenetics 10q25.2-q25.3
Domains HMG
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Wnt signaling pathway, Adherens junction, Melanogenesis, Pathways in cancer, Colorectal cancer, Endometrial cancer, Prostate cancer, Thyroid cancer, Basal cell carcinoma, Acute myeloid leukemia, Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Gene Summary This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased risk of type 2 diabetes. Several transcript variants encoding multiple different isoforms have been found for this gene.[provided by RefSeq, Oct 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.