Vasopressin V1b receptor (AVPR1B) (NM_000707) Human Tagged ORF Clone

CAT#: RG215919

Reviews ()
Write a review
  • TrueORF®

AVPR1B (GFP-tagged) - Human arginine vasopressin receptor 1B (AVPR1B)



  "NM_000707" in other vectors (6)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Vasopressin V1b receptor (AVPR1B) (NM_000707) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol AVPR1B
Synonyms AVPR3; V1bR
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG215919 representing NM_000707
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTCTGGGCCTCTGTGGGATGCCAACCCCACCCCTCGGGGCACCCTCTCTGCCCCCAATGCCACAA
CACCCTGGCTGGGCCGGGATGAGGAGCTGGCCAAGGTGGAGATCGGAGTCCTGGCCACTGTCCTGGTGCT
GGCGACCGGGGGCAACCTGGCTGTGCTGCTGACCCTGGGCCAGCTGGGCCGCAAGCGCTCCCGCATGCAC
CTGTTCGTGCTGCACTTAGCCCTGACAGACCTGGCCGTGGCGCTCTTCCAGGTGCTGCCACAGCTGCTGT
GGGACATCACCTACCGCTTCCAGGGCCCCGACCTCCTGTGCAGGGCCGTCAAGTACCTGCAGGTGCTCAG
CATGTTTGCCTCCACCTACATGCTGCTGGCCATGACGCTGGACCGCTACCTGGCTGTCTGTCACCCCCTG
CGCAGCCTCCAGCAGCCAGGCCAGTCCACCTACCTGCTCATCGCTGCTCCCTGGCTGCTGGCCGCCATCT
TCAGCCTCCCTCAAGTCTTCATTTTTTCCCTGCGGGAGGTGATCCAGGGCTCAGGGGTGCTGGACTGCTG
GGCAGACTTCGGCTTCCCTTGGGGGCCACGGGCCTACCTCACCTGGACCACCCTGGCTATCTTCGTTCTG
CCGGTGACCATGCTCACGGCCTGCTACAGCCTCATCTGCCATGAGATCTGTAAAAACCTAAAAGTCAAGA
CACAGGCCTGGCGGGTGGGAGGAGGGGGCTGGAGGACTTGGGACAGGCCCTCACCTTCCACCTTAGCTGC
CACCACTCGGGGGCTGCCATCTCGGGTCAGCAGCATCAACACCATCTCACGGGCCAAGATCCGAACAGTG
AAGATGACCTTTGTCATCGTGCTGGCCTACATCGCTTGCTGGGCTCCCTTCTTCAGTGTCCAGATGTGGT
CCGTGTGGGACAAGAATGCCCCTGATGAAGATTCCACCAATGTGGCTTTCACCATCTCTATGCTTTTGGG
CAACCTCAACAGCTGCTGCAACCCCTGGATCTACATGGGCTTCAACAGCCACCTGTTACCGCGGCCCCTG
CGTCACCTTGCCTGCTGTGGGGGTCCCCAGCCCAGGATGCGCCGGCGGCTCTCCGACGGCAGCCTCTCGA
GCCGCCACACCACGCTGCTGACCCGCTCCAGCTGCCCGGCCACCCTCAGCCTCAGCCTCAGCCTAACCCT
CAGTGGGAGGCCCAGGCCTGAAGAGTCACCAAGGGACTTGGAGCTGGCAGATGGGGAAGGCACCGCTGAG
ACCATCATCTTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG215919 representing NM_000707
Red=Cloning site Green=Tags(s)

MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMH
LFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPL
RSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVL
PVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTV
KMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPL
RHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
TIIF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000707
ORF Size 1272 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000707.2, NP_000698.1
RefSeq Size 2273 bp
RefSeq ORF 1275 bp
Locus ID 553
Cytogenetics 1q32.1
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction
Gene Summary The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1A, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor is primarily located in the anterior pituitary, where it stimulates ACTH release. It is expressed at high levels in ACTH-secreting pituitary adenomas as well as in bronchial carcinoids responsible for the ectopic ACTH syndrome. A spliced antisense transcript of this gene has been reported but its function is not known. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "AVPR1B"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit anti V1bR (pY338) Polyclonal Antibody
    • 100 ug

USD 355.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools