CARD9 (NM_052813) Human Tagged ORF Clone

CAT#: RG215899

CARD9 (GFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 763.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CARD9 (NM_052813) Human Tagged ORF Clone
Symbol CARD9
Synonyms CANDF2; hCARD9
Vector pCMV6-AC-GFP
Sequence Data
>RG215899 representing NM_052813
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGACTACGAGAACGATGACGAGTGCTGGAACGTCCTGGAGGGCTTCCGGGTGACGCTCACCTCGG
TCATCGACCCCTCACGCATCACACCTTACCTGCGGCAGTGCAAGGTCCTGAACCCTGATGATGAGGAGCA
GGTGCTCAGCGACCCCAACCTGGTCATCCGCAAACGGAAAGTGGGTGTGCTCCTGGACATCCTGCAGCGG
ACCGGCCACAAGGGCTACGTGGCCTTCCTCGAGAGCCTGGAGCTCTACTACCCGCAGCTGTACAAGAAGG
TCACAGGCAAGGAGCCGGCCCGCGTCTTCTCCATGATCATCGACGCGTCCGGGGAGTCAGGCCTGACTCA
GCTGCTGATGACTGAGGTCATGAAGCTGCAGAAGAAGGTGCAGGACCTGACCGCGCTGCTGAGCTCCAAA
GATGACTTCATCAAGGAGCTGCGGGTGAAGGACAGCCTGCTGCGCAAGCACCAGGAGCGTGTGCAGAGGC
TCAAGGAGGAGTGCGAGGCCGGCAGCCGCGAGCTCAAGCGCTGCAAGGAGGAGAACTACGACCTGGCCAT
GCGCCTGGCGCACCAGAGTGAGGAGAAGGGCGCCGCGCTCATGCGGAACCGTGACCTGCAGCTGGAGATT
GACCAGCTCAAGCACAGCCTCATGAAGGCCGAGGACGACTGCAAGGTGGAGCGCAAGCACACGCTGAAGC
TCAGGCACGCCATGGAGCAGCGGCCCAGCCAGGAGCTGCTGTGGGAGCTGCAGCAGGAGAAGGCCCTGCT
CCAGGCCCGGGTGCAGGAGCTGGAGGCCTCCGTCCAGGAGGGGAAGCTGGACAGGAGCAGCCCCTACATC
CAGGTACTGGAGGAGGACTGGCGGCAGGCGCTGCGGGACCACCAGGAGCAGGCCAACACCATCTTCTCCC
TGCGCAAGGACCTCCGCCAGGGCGAGGCCCGACGCCTCCGGTGCATGGAGGAGAAGGAGATGTTCGAGCT
GCAGTGCCTGGCACTACGTAAGGACTCCAAGATGTACAAGGACCGCATCGAGGCCATCCTGCTGCAGATG
GAGGAGGTCGCCATTGAGCGGGACCAGGCCATAGCCACGCGGGAGGAGCTGCACGCACAGCACGCCCGGG
GCCTGCAGGAGAAGGACGCGCTGCGCAAGCAGGTGCGGGAGCTGGGCGAGAAGGCGGATGAGCTGCAGCT
GCAGGTGTTCCAGTGTGAGGCGCAGCTACTGGCCGTGGAGGGCAGGCTCAGGCGGCAGCAGCTGGAGACG
CTCGTCCTGAGCTCCGACCTGGAAGATGGCTCACCCAGGAGGTCCCAGGAGCTCTCACTCCCCCAGGACC
TGGAGGACACCCAGCTCTCAGACAAAGGCTGCCTTGCCGGCGGGGGGAGCCCGAAACAGCCCTTTGCAGC
TCTGCACCAGGAGCAGGTTTTGCGGAACCCCCATGACGCAGGCCTGAGCAGCGGGGAGCCGCCCGAGAAG
GAGCGGCGGCGCCTCAAAGAGAGTTTTGAGAACTACCGCAGGAAGCGCGCCCTCAGGAAGATGCAGAAAG
GATGGCGGCAGGGGGAGGAGGACCGGGAGAACACCACGGGCAGCGACAACACCGACACTGAGGGCTCC


ACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG215899 representing NM_052813
Red=Cloning site Green=Tags(s)

MSDYENDDECWNVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQR
TGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSK
DDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEI
DQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYI
QVLEEDWRQALRDHQEQANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQM
EEVAIERDQAIATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET
LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGLSSGEPPEK
ERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS

TRPLE - GFP Tag - V
Restriction Sites SgfI-NotI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_052813
ORF Size 1608 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_052813.2, NP_434700
RefSeq Size 2136
RefSeq ORF 1611
Locus ID 64170
Cytogenetics 9q34.3
Protein Families Druggable Genome
Protein Pathways NOD-like receptor signaling pathway
Gene Summary The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)