TLR6 (NM_006068) Human Tagged ORF Clone

CAT#: RG215761

TLR6 (GFP-tagged) - Human toll-like receptor 6 (TLR6)

Change vector?

  • TrueORF®

USD 1,329.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TLR6 (NM_006068) Human Tagged ORF Clone
Symbol TLR6
Synonyms CD286; CD286
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG215761 representing NM_006068
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCAAAGACAAAGAACCTATTGTTAAAAGCTTCCATTTTGTTTGCCTTATGATCATAATAGTTGGAA
CCAGAATCCAGTTCTCCGACGGAAATGAATTTGCAGTAGACAAGTCAAAAAGAGGTCTTATTCATGTTCC
AAAAGACCTACCGCTGAAAACCAAAGTCTTAGATATGTCTCAGAACTACATCGCTGAGCTTCAGGTCTCT
GACATGAGCTTTCTATCAGAGTTGACAGTTTTGAGACTTTCCCATAACAGAATCCAGCTACTTGATTTAA
GTGTTTTCAAGTTCAACCAGGATTTAGAATATTTGGATTTATCTCATAATCAGTTGCAAAAGATATCCTG
CCATCCTATTGTGAGTTTCAGGCATTTAGATCTCTCATTCAATGATTTCAAGGCCCTGCCCATCTGTAAG
GAATTTGGCAACTTATCACAACTGAATTTCTTGGGATTGAGTGCTATGAAGCTGCAAAAATTAGATTTGC
TGCCAATTGCTCACTTGCATCTAAGTTATATCCTTCTGGATTTAAGAAATTATTATATAAAAGAAAATGA
GACAGAAAGTCTACAAATTCTGAATGCAAAAACCCTTCACCTTGTTTTTCACCCAACTAGTTTATTCGCT
ATCCAAGTGAACATATCAGTTAATACTTTAGGGTGCTTACAACTGACTAATATTAAATTGAATGATGACA
ACTGTCAAGTTTTCATTAAATTTTTATCAGAACTCACCAGAGGTTCAACCTTACTGAATTTTACCCTCAA
CCACATAGAAACGACTTGGAAATGCCTGGTCAGAGTCTTTCAATTTCTTTGGCCCAAACCTGTGGAATAT
CTCAATATTTACAATTTAACAATAATTGAAAGCATTCGTGAAGAAGATTTTACTTATTCTAAAACGACAT
TGAAAGCATTGACAATAGAACATATCACGAACCAAGTTTTTCTGTTTTCACAGACAGCTTTGTACACCGT
GTTTTCTGAGATGAACATTATGATGTTAACCATTTCAGATACACCTTTTATACACATGCTGTGTCCTCAT
GCACCAAGCACATTCAAGTTTTTGAACTTTACCCAGAACGTTTTCACAGATAGTATTTTTGAAAAATGTT
CCACGTTAGTTAAATTGGAGACACTTATCTTACAAAAAAATGGATTAAAAGACCTTTTCAAAGTAGGTCT
CATGACGAAGGATATGCCTTCTTTGGAAATACTGGATGTTAGCTGGAACTCTTTGGAATCTGGTAGACAT
AAAGAAAACTGCACTTGGGTTGAGAGTATAGTGGTGTTAAATTTGTCTTCAAATATGCTTACTGACTCTG
TTTTCAGATGTTTACCTCCCAGGATCAAGGTACTTGATCTTCACAGCAATAAAATAAAGAGCGTTCCTAA
ACAAGTCGTAAAACTGGAAGCTTTGCAAGAACTCAATGTTGCTTTCAATTCTTTAACTGACCTTCCTGGA
TGTGGCAGCTTTAGCAGCCTTTCTGTATTGATCATTGATCACAATTCAGTTTCCCACCCATCGGCTGATT
TCTTCCAGAGCTGCCAGAAGATGAGGTCAATAAAAGCAGGGGACAATCCATTCCAATGTACCTGTGAGCT
AAGAGAATTTGTCAAAAATATAGACCAAGTATCAAGTGAAGTGTTAGAGGGCTGGCCTGATTCTTATAAG
TGTGACTACCCAGAAAGTTATAGAGGAAGCCCACTAAAGGACTTTCACATGTCTGAATTATCCTGCAACA
TAACTCTGCTGATCGTCACCATCGGTGCCACCATGCTGGTGTTGGCTGTGACTGTGACCTCCCTCTGCAT
CTACTTGGATCTGCCCTGGTATCTCAGGATGGTGTGCCAGTGGACCCAGACTCGGCGCAGGGCCAGGAAC
ATACCCTTAGAAGAACTCCAAAGAAACCTCCAGTTTCATGCTTTTATTTCATATAGTGAACATGATTCTG
CCTGGGTGAAAAGTGAATTGGTACCTTACCTAGAAAAAGAAGATATACAGATTTGTCTTCATGAGAGGAA
CTTTGTCCCTGGCAAGAGCATTGTGGAAAATATCATCAACTGCATTGAGAAGAGTTACAAGTCCATCTTT
GTTTTGTCTCCCAACTTTGTCCAGAGTGAGTGGTGCCATTACGAACTCTATTTTGCCCATCACAATCTCT
TTCATGAAGGATCTAATAACTTAATCCTCATCTTACTGGAACCCATTCCACAGAACAGCATTCCCAACAA
GTACCACAAGCTGAAGGCTCTCATGACGCAGCGGACTTATTTGCAGTGGCCCAAGGAGAAAAGCAAACGT
GGGCTCTTTTGGGCTAACATTAGAGCCGCTTTTAATATGAAATTAACACTAGTCACTGAAAACAATGATG
TGAAATCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG215761 representing NM_006068
Red=Cloning site Green=Tags(s)

MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMSQNYIAELQVS
DMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPIVSFRHLDLSFNDFKALPICK
EFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRNYYIKENETESLQILNAKTLHLVFHPTSLFA
IQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEY
LNIYNLTIIESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPH
APSTFKFLNFTQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH
KENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNVAFNSLTDLPG
CGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREFVKNIDQVSSEVLEGWPDSYK
CDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAVTVTSLCIYLDLPWYLRMVCQWTQTRRRARN
IPLEELQRNLQFHAFISYSEHDSAWVKSELVPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIF
VLSPNFVQSEWCHYELYFAHHNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKR
GLFWANIRAAFNMKLTLVTENNDVKS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_006068
ORF Size 2388 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006068.2, NP_006059
RefSeq Size 2753
Locus ID 10333
Cytogenetics 4p14
Protein Families Transmembrane, Druggable Genome
Protein Pathways Toll-like receptor signaling pathway
Gene Summary The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor functionally interacts with toll-like receptor 2 to mediate cellular response to bacterial lipoproteins. A Ser249Pro polymorphism in the extracellular domain of the encoded protein may be associated with an increased of asthma is some populations.[provided by RefSeq, Jan 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.