HES5 (NM_001010926) Human Tagged ORF Clone

CAT#: RG215311

HES5 (GFP-tagged) - Human hairy and enhancer of split 5 (Drosophila) (HES5)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HES5 (NM_001010926) Human Tagged ORF Clone
Symbol HES5
Synonyms bHLHb38; bHLHb38
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG215311 representing NM_001010926
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCCCAGCACTGTGGCCGTGGAGCTGCTCAGCCCCAAAGAGAAAAACCGACTGCGGAAGCCGGTGG
TGGAGAAGATGCGCCGCGACCGCATCAACAGCAGCATCGAGCAGCTGAAGCTGCTGCTGGAGCAGGAGTT
CGCGCGGCACCAGCCCAACTCCAAGCTGGAGAAGGCCGACATCCTGGAGATGGCTGTCAGCTACCTGAAG
CACAGCAAAGCCTTCGTCGCCGCCGCCGGCCCCAAGAGCCTGCACCAGGACTACAGCGAAGGCTACTCGT
GGTGCCTGCAGGAGGCCGTGCAGTTCCTGACGCTCCACGCCGCCAGCGACACGCAGATGAAGCTGCTGTA
CCACTTCCAGCGGCCCCCGGCCGCGCCCGCCGCGCCCGCCAAGGAGCCCAAGGCGCCGGGCGCCGCGCCC
CCGCCCGCGCTCTCCGCCAAGGCCACCGCCGCCGCCGCCGCCGCGCACCAGCCCGCCTGCGGCCTCTGGC
GGCCCTGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG215311 representing NM_001010926
Red=Cloning site Green=Tags(s)

MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLK
HSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAP
PPALSAKATAAAAAAHQPACGLWRPW

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001010926
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001010926.1, NP_001010926
RefSeq Size 1306
RefSeq ORF 501
Locus ID 388585
Cytogenetics 1p36.32
Protein Families ES Cell Differentiation/IPS, Druggable Genome
Protein Pathways Notch signaling pathway
Gene Summary This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq, Dec 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations