Ceramide synthase 2(CERS2) (NM_181746) Human Tagged ORF Clone

CAT#: RG215300

CERS2 (GFP-tagged) - Human LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 546.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Ceramide synthase 2(CERS2) (NM_181746) Human Tagged ORF Clone
Symbol CERS2
Synonyms L3; LASS2; SP260; TMSG1
Vector pCMV6-AC-GFP
Sequence Data
>RG215300 representing NM_181746
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCCAGACCTTGTATGATTACTTCTGGTGGGAACGTCTGTGGCTGCCTGTGAACTTGACCTGGGCCG
ATCTAGAAGACCGAGATGGACGTGTCTACGCCAAAGCCTCAGATCTCTATATCACGCTGCCCCTGGCCTT
GCTCTTCCTCATCGTTCGATACTTCTTTGAGCTGTACGTGGCTACACCACTGGCTGCCCTCTTGAACATA
AAGGAGAAAACTCGGCTGCGGGCACCTCCCAACGCCACCTTGGAACATTTCTACCTGACCAGTGGCAAGC
AGCCCAAGCAGGTGGAAGTAGAGCTTTTGTCCCGGCAGAGCGGGCTCTCTGGCCGCCAGGTAGAGCGTTG
GTTCCGTCGCCGCCGCAACCAGGACCGGCCCAGTCTCCTCAAGAAGTTCCGAGAAGCCAGCTGGAGATTC
ACATTTTACCTGATTGCCTTCATTGCCGGCATGGCCGTCATTGTGGATAAACCCTGGTTCTATGACATGA
AGAAAGTTTGGGAGGGATATCCCATACAGAGCACTATCCCTTCCCAGTATTGGTACTACATGATTGAACT
TTCCTTCTACTGGTCCCTGCTCTTCAGCATTGCCTCTGATGTCAAGCGAAAGGATTTCAAGGAACAGATC
ATCCACCATGTGGCCACCATCATTCTCATCAGCTTTTCCTGGTTTGCCAATTACATCCGAGCTGGGACTC
TAATCATGGCTCTGCATGACTCTTCCGATTACCTGCTGGAGTCAGCCAAGATGTTTAACTACGCGGGATG
GAAGAACACCTGCAACAACATCTTCATCGTCTTCGCCATTGTTTTTATCATCACCCGACTGGTCATCCTG
CCCTTCTGGATCCTGCATTGCACCCTGGTGTACCCACTGGAGCTCTATCCTGCCTTCTTTGGCTATTACT
TCTTCAATTCCATGATGGGAGTTCTACAGCTGCTGCATATCTTCTGGGCCTACCTCATTTTGCGCATGGC
CCACAAGTTCATAACTGGAAAGCTGGTAGAAGATGAACGCAGTGACCGGGAAGAAACAGAGAGCTCAGAG
GGGGAGGAGGCTGCAGCTGGGGGAGGAGCAAAGAGCCGGCCCCTAGCCAATGGCCACCCCATCCTCAATA
ACAACCATCGTAAGAATGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG215300 representing NM_181746
Red=Cloning site Green=Tags(s)

MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI
KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF
TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI
IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL
PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE
GEEAAAGGGAKSRPLANGHPILNNNHRKND

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_181746
ORF Size 1140 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_181746.1, NP_859530
RefSeq Size 2392
RefSeq ORF 1143
Locus ID 29956
Cytogenetics 1q21.3
Protein Families Transmembrane, Transcription Factors
Gene Summary This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)