FOXP2 (NM_014491) Human Tagged ORF Clone

CAT#: RG215021

FOXP2 (GFP-tagged) - Human forkhead box P2 (FOXP2), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FOXP2 (NM_014491) Human Tagged ORF Clone
Symbol FOXP2
Synonyms CAGH44; SPCH1; TNRC10
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG215021 representing NM_014491
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCAGGAATCTGCGACAGAGACAATAAGCAACAGTTCAATGAATCAAAATGGAATGAGCACTCTAA
GCAGCCAATTAGATGCTGGCAGCAGAGATGGAAGATCAAGTGGTGACACCAGCTCTGAAGTAAGCACAGT
AGAACTGCTGCATCTGCAACAACAGCAGGCTCTCCAGGCAGCAAGACAACTTCTTTTACAGCAGCAAACA
AGTGGATTGAAATCTCCTAAGAGCAGTGATAAACAGAGACCACTGCAGGTGCCTGTGTCAGTGGCCATGA
TGACTCCCCAGGTGATCACCCCTCAGCAAATGCAGCAGATCCTTCAGCAACAAGTCCTGTCTCCTCAGCA
GCTACAAGCCCTTCTCCAACAACAGCAGGCTGTCATGCTGCAGCAGCAACAACTACAAGAGTTTTACAAG
AAACAGCAAGAGCAGTTACATCTTCAGCTTTTGCAGCAGCAGCAGCAACAGCAGCAGCAGCAACAACAGC
AGCAACAACAGCAGCAGCAACAACAACAACAACAGCAGCAACAACAGCAGCAGCAGCAGCAACAGCAGCA
GCAGCAGCAACAGCATCCTGGAAAGCAAGCGAAAGAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAATTG
GCAGCCCAGCAGCTTGTCTTCCAGCAGCAGCTTCTCCAGATGCAACAACTCCAGCAGCAGCAGCATCTGC
TCAGCCTTCAGCGTCAGGGACTCATCTCCATTCCACCTGGCCAGGCAGCACTTCCTGTCCAATCGCTGCC
TCAAGCTGGCTTAAGTCCTGCTGAGATTCAGCAGTTATGGAAAGAAGTGACTGGAGTTCACAGTATGGAA
GACAATGGCATTAAACATGGAGGGCTAGACCTCACTACTAACAATTCCTCCTCGACTACCTCCTCCAACA
CTTCCAAAGCATCACCACCAATAACTCATCATTCCATAGTGAATGGACAGTCTTCAGTTCTAAGTGCAAG
ACGAGACAGCTCGTCACATGAGGAGACTGGGGCCTCTCACACTCTCTATGGCCATGGAGTTTGCAAATGG
CCAGGCTGTGAAAGCATTTGTGAAGATTTTGGACAGTTTTTAAAGCACCTTAACAATGAACACGCATTGG
ATGACCGAAGCACTGCTCAGTGTCGAGTGCAAATGCAGGTGGTGCAACAGTTAGAAATACAGCTTTCTAA
AGAACGCGAACGTCTTCAAGCAATGATGACCCACTTGCACATGCGACCCTCAGAGCCCAAACCATCTCCC
AAACCTCTAAATCTGGTGTCTAGTGTCACCATGTCGAAGAATATGTTGGAGACATCCCCACAGAGCTTAC
CTCAAACCCCTACCACACCAACGGCCCCAGTCACCCCGATTACCCAGGGACCCTCAGTAATCACCCCAGC
CAGTGTGCCCAATGTGGGAGCCATACGAAGGCGACATTCAGACAAATACAACATTCCCATGTCATCAGAA
ATTGCCCCAAACTATGAATTTTATAAAAATGCAGATGTCAGACCTCCATTTACTTATGCAACTCTCATAA
GGCAGGCTATCATGGAGTCATCTGACAGGCAGTTAACACTTAATGAAATTTACAGCTGGTTTACACGGAC
ATTTGCTTACTTCAGGCGTAATGCAGCAACTTGGAAGAATGCAGTACGTCATAATCTTAGCCTGCACAAG
TGTTTTGTTCGAGTAGAAAATGTTAAAGGAGCAGTATGGACTGTGGATGAAGTAGAATACCAGAAGCGAA
GGTCACAAAAGATAACAGGAAGTCCAACCTTAGTAAAAAATATACCTACCAGTTTAGGCTATGGAGCAGC
TCTTAATGCCAGTTTGCAGGCTGCCTTGGCAGAGAGCAGTTTACCTTTGCTAAGTAATCCTGGACTGATA
AATAATGCATCCAGTGGCCTACTGCAGGCCGTCCACGAAGACCTCAATGGTTCTCTGGATCACATTGACA
GCAATGGAAACAGTAGTCCGGGCTGCTCACCTCAGCCGCACATACATTCAATCCACGTCAAGGAAGAGCC
AGTGATTGCAGAGGATGAAGACTGCCCAATGTCCTTAGTGACAACAGCTAATCACAGTCCAGAATTAGAA
GACGACAGAGAGATTGAAGAAGAGCCTTTATCTGAAGATCTGGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG215021 representing NM_014491
Red=Cloning site Green=Tags(s)

MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQAARQLLLQQQT
SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYK
KQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGKQAKEQQQQQQQQQQL
AAQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSME
DNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHSIVNGQSSVLSARRDSSSHEETGASHTLYGHGVCKW
PGCESICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSP
KPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSDKYNIPMSSE
IAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHK
CFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPTSLGYGAALNASLQAALAESSLPLLSNPGLI
NNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELE
DDREIEEEPLSEDLE

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_014491
ORF Size 2145 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014491.1, NP_055306
RefSeq Size 2472
RefSeq ORF 2148
Locus ID 93986
Cytogenetics 7q31.1
Domains FH
Protein Families Transcription Factors
Gene Summary This gene encodes a member of the forkhead/winged-helix (FOX) family of transcription factors. It is expressed in fetal and adult brain as well as in several other organs such as the lung and gut. The protein product contains a FOX DNA-binding domain and a large polyglutamine tract and is an evolutionarily conserved transcription factor, which may bind directly to approximately 300 to 400 gene promoters in the human genome to regulate the expression of a variety of genes. This gene is required for proper development of speech and language regions of the brain during embryogenesis, and may be involved in a variety of biological pathways and cascades that may ultimately influence language development. Mutations in this gene cause speech-language disorder 1 (SPCH1), also known as autosomal dominant speech and language disorder with orofacial dyspraxia. Multiple alternative transcripts encoding different isoforms have been identified in this gene.[provided by RefSeq, Feb 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)