CLEC16A (NM_015226) Human Tagged ORF Clone

CAT#: RG214696

CLEC16A (GFP-tagged) - Human C-type lectin domain family 16, member A (CLEC16A)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,772.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CLEC16A (NM_015226) Human Tagged ORF Clone
Symbol CLEC16A
Synonyms Gop-1; KIAA0350
Vector pCMV6-AC-GFP
Sequence Data
>RG214696 representing NM_015226
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGGCCGCTCGCGGAGCTGGGTGGGCGGGGGCCATGGCAAGACTTCCCGCAACATCCACTCCTTGG
ACCACCTCAAGTATCTGTACCACGTTTTGACCAAAAACACCACAGTCACAGAACAGAACCGGAACCTGCT
AGTGGAGACCATCCGTTCCATCACTGAGATCCTGATCTGGGGAGATCAAAATGACAGCTCTGTATTTGAC
TTCTTCCTGGAGAAGAATATGTTTGTTTTCTTCTTGAACATCTTGCGGCAAAAGTCGGGCCGTTACGTGT
GCGTTCAGCTGCTGCAGACCTTGAACATCCTCTTTGAGAACATCAGTCACGAGACCTCACTTTATTATTT
GCTCTCAAATAACTACGTAAATTCTATCATCGTTCATAAATTTGACTTTTCTGATGAGGAGATTATGGCC
TATTATATATCGTTCCTGAAAACACTTTCGTTAAAACTCAACAACCACACTGTCCATTTCTTTTATAATG
AGCACACCAATGACTTTGCCCTGTACACAGAAGCCATCAAGTTTTTCAACCACCCTGAAAGCATGGTTAG
AATTGCTGTAAGAACCATAACTTTGAATGTCTATAAAGTGTCATTGGATAACCAGGCCATGCTGCACTAC
ATCCGAGATAAAACTGCTGTTCCTTACTTCTCCAATTTGGTCTGGTTCATTGGGAGCCATGTGATCGAAC
TCGATGACTGCGTGCAGACTGATGAGGAGCATCGGAATCGGGGTAAACTGAGTGATCTGGTGGCAGAGCA
CCTAGACCACCTGCACTATCTCAATGACATCCTGATCATCAACTGTGAGTTCCTCAACGATGTGCTCACT
GACCACCTGCTCAACAGGCTCTTCCTGCCCCTCTACGTGTACTCACTGGAGAACCAGGACAAGGGAGGAG
AACGGCCGAAAATTAGCCTGCCGGTGTCTCTTTATCTTCTGTCACAGGTCTTCTTAATTATACATCATGC
ACCGCTGGTGAACTCGTTAGCTGAAGTCATTCTGAATGGTGATCTGTCTGAGATGTACGCTAAGACTGAA
CAGGATATTCAGAGAAGTTCTGCCAAGCCCAGCATTCGGTGCTTCATTAAACCCACCGAGACACTCGAGC
GGTCCCTTGAGATGAACAAGCACAAGGGCAAGAGGCGGGTGCAAAAGAGACCCAACTACAAAAACGTTGG
GGAAGAAGAAGATGAGGAGAAAGGGCCCACCGAGGATGCCCAAGAAGACGCCGAGAAGGCTAAAGGTACA
GAGGGTGGTTCAAAAGGCATCAAGACGAGTGGGGAGAGTGAAGAGATCGAGATGGTGATCATGGAGCGTA
GCAAGCTCTCAGAGCTGGCCGCCAGCACCTCCGTGCAGGAGCAGAACACCACGGACGAGGAGAAAAGCGC
CGCCGCCACCTGCTCTGAGAGCACGCAATGGAGCAGACCCTTCCTGGATATGGTGTACCACGCGCTGGAC
AGCCCGGATGATGATTACCATGCCCTGTTCGTGCTCTGCCTCCTCTATGCCATGTCTCATAATAAAGGCA
TGGATCCTGAAAAATTAGAGCGAATCCAGCTCCCCGTGCCAAATGCGGCCGAGAAGACCACCTACAACCA
CCCGCTAGCTGAAAGACTCATCAGGATCATGAACAACGCTGCCCAGCCAGATGGGAAGATCCGGCTGGCG
ACGCTGGAGCTGAGCTGCCTGCTTCTGAAGCAGCAAGTCCTGATGAGTGCTGGCTGCATCATGAAGGACG
TGCACCTGGCCTGCCTGGAGGGTGCGAGAGAAGAAAGTGTTCACCTTGTACGACATTTTTATAAGGGAGA
AGACATTTTTTTGGACATGTTTGAAGATGAGTATAGGAGCATGACAATGAAGCCCATGAACGTGGAATAT
CTCATGATGGACGCCTCCATCCTGCTGCCCCCAACAGGCACGCCACTGACGGGCATTGACTTCGTGAAGC
GGCTGCCGTGTGGCGATGTGGAGAAGACCCGGCGGGCCATCCGGGTGTTCTTCATGCTGCGTTCCCTGTC
ACTGCAATTGCGAGGGGAGCCTGAGACACAGTTGCCGCTGACTCGGGAGGAGGACCTGATCAAGACTGAT
GATGTCCTGGATCTGAATAACAGCGACTTGATTGCATGTACAGTGATCACCAAGGATGGCGGCATGGTCC
AGCGATTCCTGGCTGTGGATATTTACCAGATGAGTTTGGTGGAGCCTGATGTGTCCAGGCTTGGCTGGGG
AGTGGTCAAGTTTGCAGGCCTATTGCAGGACATGCAGGTGACTGGCGTGGAGGACGACAGCCGTGCCCTG
AACATCACCATCCACAAGCCTGCGTCCAGCCCCCATTCCAAGCCCTTCCCCATCCTCCAGGCCACCTTCA
TCTTCTCAGACCACATCCGCTGCATCATCGCCAAGCAGCGCCTGGCCAAAGGCCGCATCCAGGCAAGGCG
CATGAAGATGCAGAGAATAGCTGCCCTCCTGGACCTCCCAATCCAGCCCACCACTGAAGTCCTGGGGTTT
GGACTCGGCTCCTCCACCTCCACTCAGCACCTGCCTTTCCGCTTCTACGACCAGGGGCGCCGGGGCAGCA
GCGACCCCACAGTGCAGCGCTCCGTGTTTGCATCGGTGGACAAGGTGCCAGGCTTCGCCGTGGCCCAGTG
CATAAACCAGCACAGCTCCCCGTCCCTGTCCTCACAGTCGCCACCCTCCGCCAGCGGGAGCCCCAGCGGC
AGCGGGAGCACCAGCCACTGCGACTCTGGAGGCACCAGCTCGTCCTCCACCCCCTCCACAGCCCAGAGTC
CAGCAGATGCCCCCATGAGTCCAGAACTGCCTAAGCCTCACCTTCCTGACCAGTTGGTAATCGTCAACGA
AACGGAAGCAGACTCTAAGCCCAGCAAGAACGTGGCCAGGAGCGCAGCCGTGGAGACAGCCAGCCTGTCC
CCCAGCCTCGTCCCTGCCCGGCAGCCCACCATTTCCCTGCTCTGCGAGGACACGGCTGACACGCTGAGCG
TCGAATCGCTGACCCTTGTCCCCCCAGTTGACCCCCACAGCCTCCGCAGCCTCACCGGCATGCCCCCGCT
GTCCACGCCGGCTGCCGCCTGCACAGAGCCCGTGGGCGAAGAGGCTGCATGTGCTGAGCCTGTGGGCACC
GCTGAGGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG214696 representing NM_015226
Red=Cloning site Green=Tags(s)

MFGRSRSWVGGGHGKTSRNIHSLDHLKYLYHVLTKNTTVTEQNRNLLVETIRSITEILIWGDQNDSSVFD
FFLEKNMFVFFLNILRQKSGRYVCVQLLQTLNILFENISHETSLYYLLSNNYVNSIIVHKFDFSDEEIMA
YYISFLKTLSLKLNNHTVHFFYNEHTNDFALYTEAIKFFNHPESMVRIAVRTITLNVYKVSLDNQAMLHY
IRDKTAVPYFSNLVWFIGSHVIELDDCVQTDEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLT
DHLLNRLFLPLYVYSLENQDKGGERPKISLPVSLYLLSQVFLIIHHAPLVNSLAEVILNGDLSEMYAKTE
QDIQRSSAKPSIRCFIKPTETLERSLEMNKHKGKRRVQKRPNYKNVGEEEDEEKGPTEDAQEDAEKAKGT
EGGSKGIKTSGESEEIEMVIMERSKLSELAASTSVQEQNTTDEEKSAAATCSESTQWSRPFLDMVYHALD
SPDDDYHALFVLCLLYAMSHNKGMDPEKLERIQLPVPNAAEKTTYNHPLAERLIRIMNNAAQPDGKIRLA
TLELSCLLLKQQVLMSAGCIMKDVHLACLEGAREESVHLVRHFYKGEDIFLDMFEDEYRSMTMKPMNVEY
LMMDASILLPPTGTPLTGIDFVKRLPCGDVEKTRRAIRVFFMLRSLSLQLRGEPETQLPLTREEDLIKTD
DVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRAL
NITIHKPASSPHSKPFPILQATFIFSDHIRCIIAKQRLAKGRIQARRMKMQRIAALLDLPIQPTTEVLGF
GLGSSTSTQHLPFRFYDQGRRGSSDPTVQRSVFASVDKVPGFAVAQCINQHSSPSLSSQSPPSASGSPSG
SGSTSHCDSGGTSSSSTPSTAQSPADAPMSPELPKPHLPDQLVIVNETEADSKPSKNVARSAAVETASLS
PSLVPARQPTISLLCEDTADTLSVESLTLVPPVDPHSLRSLTGMPPLSTPAAACTEPVGEEAACAEPVGT
AED

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_015226
ORF Size 3159 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015226.1, NP_056041
RefSeq Size 6786
RefSeq ORF 3162
Locus ID 23274
Cytogenetics 16p13.13
Gene Summary This gene encodes a member of the C-type lectin domain containing family. Single nucleotide polymorphisms in introns of this gene have been associated with diabetes mellitus, multiple sclerosis and rheumatoid arthritis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)