GPR120(FFAR4) (NM_181745) Human Tagged ORF Clone

CAT#: RG214159

FFAR4 (GFP-tagged) - Human omega-3 fatty acid receptor 1 (O3FAR1), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 546.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name GPR120(FFAR4) (NM_181745) Human Tagged ORF Clone
Symbol FFAR4
Synonyms BMIQ10; GPR120; GPR129; GT01; O3FAR1; PGR4
Vector pCMV6-AC-GFP
Sequence Data
>RG214159 representing NM_181745
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCCTGAATGCGCGCGGGCAGCGGGCGACGCGCCCTTGCGCAGCCTGGAACAAGCCAACCGCACCC
GCTTTCCCTTCTTCTCCGACGTCAAGGGCGACCACCGGCTGGTGCTGGCCGCGGTGGAGACAACCGTGCT
GGTGCTCATCTTTGCAGTGTCGCTGCTGGGCAACGTGTGCGCCCTGGTGCTGGTGGCGCGCCGACGACGC
CGCGGCGCGACTGCCTGCCTGGTACTCAACCTCTTCTGCGCGGACCTGCTCTTCATCAGCGCTATCCCTC
TGGTGCTGGCCGTGCGCTGGACTGAGGCCTGGCTGCTGGGCCCCGTTGCCTGCCACCTGCTCTTCTACGT
GATGACCCTGAGCGGCAGCGTCACCATCCTCACGCTGGCCGCGGTCAGCCTGGAGCGCATGGTGTGCATC
GTGCACCTGCAGCGCGGCGTGCGGGGTCCTGGGCGGCGGGCGCGGGCAGTGCTGCTGGCGCTCATCTGGG
GCTATTCGGCGGTCGCCGCTCTGCCTCTCTGCGTCTTCTTCCGAGTCGTCCCGCAACGGCTCCCCGGCGC
CGACCAGGAAATTTCGATTTGCACACTGATTTGGCCCACCATTCCTGGAGAGATCTCGTGGGATGTCTCT
TTTGTTACTTTGAACTTCTTGGTGCCAGGACTGGTCATTGTGATCAGTTACTCCAAAATTTTACAGACCT
CGGRACACCTCCTGGATGCAAGAGCTGTCGTGACTCACAGTGAGATCACAAAGGCATCAAGGAAGAGGCT
CACGGTAAGCCTGGCCTACTCGGAGAGCCACCAGATCCGCGTGTCCCAGCAGGACTTCCGGCTCTTCCGC
ACCCTCTTCCTCCTCATGGTCTCCTTCTTCATCATGTGGAGCCCCATCATCATCACCATCCTCCTCATCC
TGATCCAGAACTTCAAGCAAGACCTGGTCATCTGGCCGTCCCTCTTCTTCTGGGTGGTGGCCTTCACATT
TGCTAATTCAGCCCTAAACCCCATCCTCTACAACATGACACTGTGCAGGAATGAGTGGAAGAAAATTTTT
TGCTGCTTCTGGTTCCCAGAAAAGGGAGCCATTTTAACAGACACATCTGTCAAAAGAAATGACTTGTCGA
TTATTTCTGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG214159 representing NM_181745
Red=Cloning site Green=Tags(s)

MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRR
RGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCI
VHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVS
FVTLNFLVPGLVIVISYSKILQTSXHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFR
TLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIF
CCFWFPEKGAILTDTSVKRNDLSIISG

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_181745
ORF Size 1131 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_181745.2, NP_859529
RefSeq Size 1190
RefSeq ORF 1134
Locus ID 338557
Cytogenetics 10q23.33
Protein Families Transmembrane, Druggable Genome
Gene Summary This gene encodes a G protein-coupled receptor (GPR) which belongs to the rhodopsin family of GPRs. The encoded protein functions as a receptor for free fatty acids, including omega-3, and participates in suppressing anti-inflammatory responses and insulin sensitizing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)