CLCN3 (NM_001829) Human Tagged ORF Clone

CAT#: RG214128

CLCN3 (GFP-tagged) - Human chloride channel 3 (CLCN3), transcript variant b

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,381.00


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CLCN3 (NM_001829) Human Tagged ORF Clone
Symbol CLCN3
Synonyms ClC-3; CLC3
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG214128 representing NM_001829
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGGCGCGCCC

ATGGAGTCTGAGCAGCTGTTCCATAGAGGCTACTATAGAAACAGCTACAACAGTATAACAAGTGCAAGTA
GTGATGAGGAACTTTTAGATGGAGCAGGTGTTATTATGGACTTTCAAACATCTGAAGATGACAATTTATT
AGATGGTGACACTGCAGTTGGAACTCATTATACAATGACAAATGGAGGCAGCATTAACAGTTCTACACAT
TTACTGGATCTTTTGGATGAACCAATTCCAGGTGTTGGTACATATGATGATTTCCATACTATTGATTGGG
TGCGAGAAAAATGTAAAGACAGAGAAAGGCATAGACGGATCAACAGCAAAAAGAAAGAATCAGCATGGGA
AATGACAAAAAGTTTGTATGATGCGTGGTCAGGATGGCTAGTAGTAACACTAACAGGATTGGCATCAGGG
GCACTGGCCGGATTAATAGACATTGCTGCCGATTGGATGACTGACCTAAAGGAGGGCATTTGCCTTAGTG
CGTTGTGGTACAACCACGAACAGTGCTGTTGGGGATCTAATGAAACAACATTTGAAGAGAGGGATAAATG
TCCACAGTGGAAAACATGGGCAGAATTAATCATAGGTCAAGCAGAGGGTCCTGGTTCTTATATCATGAAC
TACATAATGTACATCTTCTGGGCCTTGAGTTTTGCCTTTCTTGCAGTTTCCCTGGTAAAGGTATTTGCTC
CATATGCCTGTGGCTCTGGAATTCCAGAGATTAAAACTATTTTAAGTGGATTCATCATCAGAGGTTACTT
GGGAAAATGGACTTTAATGATTAAAACCATCACATTAGTCCTGGCTGTGGCATCAGGTTTGAGTTTAGGA
AAAGAAGGTCCCCTGGTACATGTTGCCTGTTGCTGCGGAAATATCTTTTCCTACCTCTTTCCAAAGTATA
GCACAAACGAAGCTAAAAAAAGGGAGGTGCTATCAGCTGCCTCAGCTGCAGGGGTTTCTGTAGCTTTTGG
TGCACCAATTGGAGGAGTTCTTTTTAGCCTGGAAGAGGTTAGCTATTATTTTCCTCTCAAAACTTTATGG
AGATCATTTTTTGCTGCTTTAGTGGCTGCATTTGTTTTGAGGTCCATCAATCCATTTGGTAACAGCCGTC
TGGTCCTTTTTTATGTGGAGTATCATACACCATGGTACCTTTTTGAACTGTTTCCTTTTATTCTTCTAGG
GGTATTTGGAGGGCTTTGGGGAGCCTTTTTCATTAGGGCAAATATTGCCTGGTGTCGTCGACGCAAGTCC
ACGAAATTTGGAAAGTATCCCGTTCTGGAAGTCATTATTGTTGCAGCCATTACTGCTGTGATAGCCTTCC
CTAATCCATACACTAGGCTAAACACCAGTGAACTGATCAAAGAGCTTTTTACAGACTGTGGTCCCCTGGA
ATCCTCTTCTCTTTGTGACTACAGAAATGACATGAATGCCAGTAAAATTGTCGATGACATTCCTGATCGT
CCAGCAGGCATTGGAGTATATTCAGCTATATGGCAGTTATGCCTGGCACTCATATTTAAAATCATAATGA
CAGTATTCACTTTTGGCATCAAGGTTCCATCAGGCTTGTTCATCCCCAGCATGGCCATTGGAGCGATCGC
AGGAAGGATTGTGGGGATTGCGGTGGAGCAGCTTGCCTACTATCACCACGACTGGTTTATCTTTAAGGAG
TGGTGTGAGGTCGGGGCTGATTGCATTACACCTGGCCTTTATGCCATGGTTGGTGCTGCTGCATGCTTAG
GTGGTGTGACAAGAATGACTGTCTCCCTGGTGGTTATTGTTTTTGAGCTTACTGGAGGCTTGGAATATAT
TGTTCCCCTTATGGCTGCAGTCATGACCAGTAAATGGGTTGGAGATGCCTTTGGCAGGGAAGGCATTTAT
GAAGCACACATCCGATTAAATGGATACCCTTTCTTGGATGCAAAAGAAGAATTCACTCATACCACCCTGG
CTGCTGACGTTATGAGACCTCGAAGGAATGATCCTCCCTTAGCTGTCCTGACACAGGACAATATGACAGT
GGATGATATAGAAAACATGATTAATGAAACCAGCTACAATGGATTTCCTGTCATAATGTCAAAAGAATCT
CAGAGATTAGTGGGATTTGCCCTCAGAAGAGACCTGACAATTGCAATAGAAAGTGCCAGGAAAAAACAAG
AAGGTATCGTTGGCAGTTCTCGGGTGTGTTTTGCACAGCACACCCCATCTCTTCCAGCAGAAAGTCCTCG
GCCATTGAAGCTTCGAAGCATTCTTGACATGAGCCCTTTTACAGTGACAGACCACACCCCAATGGAGATC
GTGGTGGATATTTTCCGAAAGCTGGGACTGAGGCAGTGCCTTGTAACTCACAATGGGCGCCTCCTTGGCA
TTATAACAAAAAAAGATATCCTCCGGCATATGGCCCAGACGGCAAACCAAGACCCCGCTTCAATAATGTT
CAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG214128 representing NM_001829
Red=Cloning site Green=Tags(s)

MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTH
LLDLLDEPIPGVGTYDDFHTIDWVREKCKDRERHRRINSKKKESAWEMTKSLYDAWSGWLVVTLTGLASG
ALAGLIDIAADWMTDLKEGICLSALWYNHEQCCWGSNETTFEERDKCPQWKTWAELIIGQAEGPGSYIMN
YIMYIFWALSFAFLAVSLVKVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLMIKTITLVLAVASGLSLG
KEGPLVHVACCCGNIFSYLFPKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLW
RSFFAALVAAFVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGVFGGLWGAFFIRANIAWCRRRKS
TKFGKYPVLEVIIVAAITAVIAFPNPYTRLNTSELIKELFTDCGPLESSSLCDYRNDMNASKIVDDIPDR
PAGIGVYSAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHDWFIFKE
WCEVGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIY
EAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSKES
QRLVGFALRRDLTIAIESARKKQEGIVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEI
VVDIFRKLGLRQCLVTHNGRLLGIITKKDILRHMAQTANQDPASIMFN

TRTRPLE - GFP Tag - V
Restriction Sites AscI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001829
ORF Size 2454 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001829.2, NP_001820
RefSeq Size 3982
RefSeq ORF 2457
Locus ID 1182
Cytogenetics 4q33
Domains CBS, voltage_CLC
Protein Families Ion Channels: Other, Transmembrane, Druggable Genome
Gene Summary This gene encodes a member of the voltage-gated chloride channel (ClC) family. The encoded protein is present in all cell types and localized in plasma membranes and in intracellular vesicles. It is a multi-pass membrane protein which contains a ClC domain and two additional C-terminal CBS (cystathionine beta-synthase) domains. The ClC domain catalyzes the selective flow of Cl- ions across cell membranes, and the CBS domain may have a regulatory function. This protein plays a role in both acidification and transmitter loading of GABAergic synaptic vesicles, and in smooth muscle cell activation and neointima formation. This protein is required for lysophosphatidic acid (LPA)-activated Cl- current activity and fibroblast-to-myofibroblast differentiation. The protein activity is regulated by Ca(2+)/calmodulin-dependent protein kinase II (CaMKII) in glioma cells. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)