GLUT4(SLC2A4) (NM_001042) Human Tagged ORF Clone

CAT#: RG213717

SLC2A4 (GFP-tagged) - Human solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4)

Change vector?

  • TrueORF®

USD 721.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GLUT4(SLC2A4) (NM_001042) Human Tagged ORF Clone
Symbol SLC2A4
Synonyms GLUT4; GLUT4
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG213717 representing NM_001042
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTCGGGCTTCCAACAGATAGGCTCCGAAGATGGGGAACCCCCTCAGCAGCGAGTGACTGGGACCC
TGGTCCTTGCTGTGTTCTCTGCGGTGCTTGGCTCCCTGCAGTTTGGGTACAACATTGGGGTCATCAATGC
CCCTCAGAAGGTGATTGAACAGAGCTACAATGAGACGTGGCTGGGGAGGCAGGGGCCTGAGGGACCCAGC
TCCATCCCTCCAGGCACCCTCACCACCCTCTGGGCCCTCTCCGTGGCCATCTTTTCCGTGGGCGGCATGA
TTTCCTCCTTCCTCATTGGTATCATCTCTCAGTGGCTTGGAAGGAAAAGGGCCATGCTGGTCAACAATGT
CCTGGCGGTGCTGGGGGGCAGCCTCATGGGCCTGGCCAACGCTGCTGCCTCCTATGAAATGCTCATCCTT
GGACGATTCCTCATTGGCGCCTACTCAGGGCTGACATCAGGGCTGGTGCCCATGTACGTGGGGGAGATTG
CTCCCACTCACCTGCGGGGCGCCCTGGGGACGCTCAACCAACTGGCCATTGTTATCGGCATTCTGATCGC
CCAGGTGCTGGGCTTGGAGTCCCTCCTGGGCACTGCCAGCCTGTGGCCACTGCTCCTGGGCCTCACAGTG
CTACCTGCCCTCCTGCAGCTGGTCCTGCTGCCCTTCTGTCCCGAGAGCCCCCGCTACCTCTACATCATCC
AGAATCTCGAGGGGCCTGCCAGAAAGAGTCTGAAGCGCCTGACAGGCTGGGCCGATGTTTCTGGAGTGCT
GGCTGAGCTGAAGGATGAGAAGCGGAAGCTGGAGCGTGAGCGGCCACTGTCCCTGCTCCAGCTCCTGGGC
AGCCGTACCCACCGGCAGCCCCTGATCATTGCGGTCGTGCTGCAGCTGAGCCAGCAGCTCTCTGGCATCA
ATGCTGTTTTCTATTATTCGACCAGCATCTTCGAGACAGCAGGGGTAGGCCAGCCTGCCTATGCCACCAT
AGGAGCTGGTGTGGTCAACACAGTCTTCACCTTGGTCTCGGTGTTGTTGGTGGAGCGGGCGGGGCGCCGG
ACGCTCCATCTCCTGGGCCTGGCGGGCATGTGTGGCTGTGCCATCCTGATGACTGTGGCTCTGCTCCTGC
TGGAGCGAGTTCCAGCCATGAGCTACGTCTCCATTGTGGCCATCTTTGGCTTCGTGGCATTTTTTGAGAT
TGGCCCTGGCCCCATTCCTTGGTTCATCGTGGCCGAGCTCTTCAGCCAGGGACCCCGCCCGGCAGCCATG
GCTGTGGCTGGTTTCTCCAACTGGACGAGCAACTTCATCATTGGCATGGGTTTCCAGTATGTTGCGGAGG
CTATGGGGCCCTACGTCTTCCTTCTATTTGCGGTCCTCCTGCTGGGCTTCTTCATCTTCACCTTCTTAAG
AGTACCTGAAACTCGAGGCCGGACGTTTGACCAGATCTCAGCTGCCTTCCACCGGACACCCTCTCTTTTA
GAGCAGGAGGTGAAACCCAGCACAGAACTTGAGTATTTAGGGCCAGATGAGAACGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG213717 representing NM_001042
Red=Cloning site Green=Tags(s)

MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPS
SIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLIL
GRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTV
LPALLQLVLLPFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLG
SRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRR
TLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLL
EQEVKPSTELEYLGPDEND

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001042
ORF Size 1527 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001042.1, NP_001033
RefSeq Size 2128
Locus ID 6517
Cytogenetics 17p13.1
Protein Families Transmembrane, Druggable Genome
Protein Pathways Insulin signaling pathway, Adipocytokine signaling pathway, Type II diabetes mellitus
Gene Summary This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations