alpha 1a Adrenergic Receptor(ADRA1A) (NM_033302) Human Tagged ORF Clone

CAT#: RG213253

ADRA1A (GFP-tagged) - Human adrenergic, alpha-1A-, receptor (ADRA1A), transcript variant 3

Change vector?

  • TrueORF®

USD 608.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name alpha 1a Adrenergic Receptor(ADRA1A) (NM_033302) Human Tagged ORF Clone
Symbol ADRA1A
Synonyms ADRA1C; ADRA1L1; ALPHA1AAR
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG213253 representing NM_033302
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGTTTCTCTCGGGAAATGCTTCCGACAGCTCCAACTGCACCCAACCGCCGGCACCGGTGAACATTT
CCAAGGCCATTCTGCTCGGGGTGATCTTGGGGGGCCTCATTCTTTTCGGGGTGCTGGGTAACATCCTAGT
GATCCTCTCCGTAGCCTGTCACCGACACCTGCACTCAGTCACGCACTACTACATCGTCAACCTGGCGGTG
GCCGACCTCCTGCTCACCTCCACGGTGCTGCCCTTCTCCGCCATCTTCGAGGTCCTAGGCTACTGGGCCT
TCGGCAGGGTCTTCTGCAACATCTGGGCGGCAGTGGATGTGCTGTGCTGCACCGCGTCCATCATGGGCCT
CTGCATCATCTCCATCGACCGCTACATCGGCGTGAGCTACCCGCTGCGCTACCCAACCATCGTCACCCAG
AGGAGGGGTCTCATGGCTCTGCTCTGCGTCTGGGCACTCTCCCTGGTCATATCCATTGGACCCCTGTTCG
GCTGGAGGCAGCCGGCCCCCGAGGACGAGACCATCTGCCAGATCAACGAGGAGCCGGGCTACGTGCTCTT
CTCAGCGCTGGGCTCCTTCTACCTGCCTCTGGCCATCATCCTGGTCATGTACTGCCGCGTCTACGTGGTG
GCCAAGAGGGAGAGCCGGGGCCTCAAGTCTGGCCTCAAGACCGACAAGTCGGACTCGGAGCAAGTGACGC
TCCGCATCCATCGGAAAAACGCCCCGGCAGGAGGCAGCGGGATGGCCAGCGCCAAGACCAAGACGCACTT
CTCAGTGAGGCTCCTCAAGTTCTCCCGGGAGAAGAAAGCGGCCAAAACGCTGGGCATCGTGGTCGGCTGC
TTCGTCCTCTGCTGGCTGCCTTTTTTCTTAGTCATGCCCATTGGGTCTTTCTTCCCTGATTTCAAGCCCT
CTGAAACAGTTTTTAAAATAGTATTTTGGCTCGGATATCTAAACAGCTGCATCAACCCCATCATATACCC
ATGCTCCAGCCAAGAGTTCAAAAAGGCCTTTCAGAATGTCTTGAGAATCCAGTGTCTCCGCAGAAAGCAG
TCTTCCAAACATGCCCTGGGCTACACCCTGCACCCGCCCAGCCAGGCCGTGGAAGGGCAACACAAGGACA
TGGTGCGCATCCCCGTGGGATCAAGAGAGACCTTCTACAGGATCTCCAAGACGGATGGCGTTTGTGAATG
GAAATTTTTCTCTTCCATGCCCCGTGGATCTGCCAGGATTACAGTGTCCAAAGACCAATCCTCCTGTACC
ACAGCCCGGGGACACACACCCATGACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG213253 representing NM_033302
Red=Cloning site Green=Tags(s)

MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAV
ADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQ
RRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVV
AKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGC
FVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQ
SSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARGHTPMT

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_033302
ORF Size 1287 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_033302.1, NP_150645
RefSeq Size 2089
Locus ID 148
Cytogenetics 8p21.2
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction
Gene Summary Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. This gene encodes alpha-1A-adrenergic receptor. Alternative splicing of this gene generates four transcript variants, which encode four different isoforms with distinct C-termini but having similar ligand binding properties. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.