Eph receptor A5(EPHA5) (NM_004439) Human Tagged ORF Clone

CAT#: RG213206

EPHA5 (GFP-tagged) - Human EPH receptor A5 (EPHA5), transcript variant 1

Change vector?

  • TrueORF®

USD 917


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Eph receptor A5(EPHA5) (NM_004439) Human Tagged ORF Clone
Symbol EPHA5
Synonyms CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG213206 representing NM_004439
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGGGCTCGGGGCCCCGGGGTGCGGGACACCGGCGGCCCCCAAGCGGCGGCGGCGACACCCCCATCA
CCCCAGCGTCCCTGGCCGGCTGCTACTCTGCACCTCGACGGGCTCCCCTCTGGACGTGCCTTCTCCTGTG
CGCCGCACTCCGGACCCTCCTGGCCAGCCCCAGCAACGAAGTGAATTTATTGGATTCACGCACTGTCATG
GGGGACCTGGGATGGATTGCTTTTCCAAAAAATGGGTGGGAAGAGATTGGTGAAGTGGATGAAAATTATG
CCCCTATCCACACATACCAAGTATGCAAAGTGATGGAACAGAATCAGAATAACTGGCTTTTGACCAGTTG
GATCTCCAATGAAGGTGCTTCCAGAATCTTCATAGAACTCAAATTTACCCTGCGGGACTGCAACAGCCTT
CCTGGAGGACTGGGGACCTGTAAGGAAACCTTTAATATGTATTACTTTGAGTCAGATGATCAGAATGGGA
GAAACATCAAGGAAAACCAATACATCAAAATTGATACCATTGCTGCCGATGAAAGCTTTACAGAACTTGA
TCTTGGTGACCGTGTTATGAAACTGAATACAGAGGTCAGAGATGTAGGACCTCTAAGCAAAAAGGGATTT
TATCTTGCTTTTCAAGATGTTGGTGCTTGCATTGCTCTGGTTTCTGTGCGTGTATACTATAAAAAATGCC
CTTCTGTGGTACGACACTTGGCTGTCTTCCCTGACACCATCACTGGAGCTGATTCTTCCCAATTGCTCGA
AGTGTCAGGCTCCTGTGTCAACCATTCTGTGACCGATGAACCTCCCAAAATGCACTGCAGCGCCGAAGGG
GAGTGGCTGGTGCCCATCGGGAAATGCATGTGCAAGGCAGGATATGAAGAGAAAAATGGCACCTGTCAAG
TGTGCAGACCTGGGTTCTTCAAAGCCTCACCTCACATCCAGAGCTGCGGCAAATGTCCACCTCACAGTTA
TACCCATGAGGAAGCTTCAACCTCTTGTGTCTGTGAAAAGGATTATTTCAGGAGAGAGTCTGATCCACCC
ACAATGGCATGCACAAGACCCCCCTCTGCTCCTCGGAATGCCATCTCAAATGTTAATGAAACTAGTGTCT
TTCTGGAATGGATTCCGCCTGCTGACACTGGTGGAAGGAAAGACGTGTCATATTATATTGCATGCAAGAA
GTGCAACTCCCATGCAGGTGTGTGTGAGGAGTGTGGCGGTCATGTCAGGTACCTTCCCCGGCAAAGCGGC
CTGAAAAACACCTCTGTCATGATGGTGGATCTACTCGCTCACACAAACTATACCTTTGAGATTGAGGCAG
TGAATGGAGTGTCCGACTTGAGCCCAGGAGCCCGGCAGTATGTGTCTGTAAATGTAACCACAAATCAAGC
AGCTCCATCTCCAGTCACCAATGTGAAAAAAGGGAAAATTGCAAAAAACAGCATCTCTTTGTCTTGGCAA
GAACCAGATCGTCCCAATGGAATCATCCTAGAGTATGAAATCAAGTATTTTGAAAAGGACCAAGAGACCA
GCTACACGATTATCAAATCTAAAGAGACAACTATTACTGCAGAGGGCTTGAAACCAGCTTCAGTTTATGT
CTTCCAAATTCGAGCACGTACAGCAGCAGGCTATGGTGTCTTCAGTCGAAGATTTGAGTTTGAAACCACC
CCAGTGTTTGCAGCATCCAGCGATCAAAGCCAGATTCCTGTAATTGCTGTGTCTGTGACAGTGGGAGTCA
TTTTGTTGGCAGTGGTTATCGGCGTCCTCCTCAGTGGAAGTTGCTGCGAATGTGGCTGTGGGAGGGCTTC
TTCCCTGTGCGCTGTTGCCCATCCAAGCCTAATATGGCGGTGTGGCTACAGCAAAGCAAAACAAGATCCA
GAAGAGGAAAAGATGCATTTTCATAATGGGCACATTAAACTGCCAGGAGTAAGAACTTACATTGATCCAC
ATACCTATGAGGATCCCAATCAAGCTGTCCACGAATTTGCTAAGGAGATAGAAGCATCATGTATCACCAT
TGAGAGAGTTATTGGAGCAGGTGAATTTGGTGAAGTTTGTAGTGGACGTTTGAAACTACCAGGAAAAAGA
GAATTACCTGTGGCTATCAAAACCCTTAAAGTAGGCTATACTGAAAAGCAACGCAGAGATTTCCTAGGTG
AAGCAAGTATCATGGGACAGTTTGATCATCCTAACATCATCCATTTAGAAGGTGTGGTGACCAAAAGTAA
ACCAGTGATGATCGTGACAGAGTATATGGAGAATGGCTCTTTAGATACATTTTTGAAGAAAAACGATGGG
CAGTTCACTGTGATTCAGCTTGTTGGCATGCTGAGAGGTATCTCTGCAGGAATGAAGTACCTTTCTGACA
TGGGCTATGTGCATAGAGATCTTGCTGCCAGAAACATCTTAATCAACAGTAACCTTGTGTGCAAAGTGTC
TGACTTTGGACTTTCCCGGGTACTGGAAGATGATCCCGAGGCAGCCTACACCACAAGGGGAGGAAAAATT
CCAATCAGATGGACTGCCCCAGAAGCAATAGCTTTCCGAAAGTTTACTTCTGCCAGTGATGTCTGGAGTT
ATGGAATAGTAATGTGGGAAGTTGTGTCTTATGGAGAGAGACCCTACTGGGAGATGACCAATCAAGATGT
GATTAAAGCGGTAGAGGAAGGCTATCGTCTGCCAAGCCCCATGGATTGTCCTGCTGCTCTCTATCAGTTA
ATGCTGGATTGCTGGCAGAAAGAGCGAAATAGCAGGCCCAAGTTTGATGAAATAGTCAACATGTTGGACA
AGCTGATACGTAACCCAAGTAGTCTGAAGACGCTGGTTAATGCATCCTGCAGAGTATCTAATTTATTGGC
AGAACATAGCCCACTAGGATCTGGGGCCTACAGATCAGTAGGTGAATGGCTAGAGGCAATCAAGATGGGC
CGGTATACAGAGATTTTCATGGAAAATGGATACAGTTCAATGGACGCTGTGGCTCAGGTGACCTTGGAGG
ATTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAA
GGTGCAGCTGGTAAACGGAATGGTGCCATTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG213206 representing NM_004439
Red=Cloning site Green=Tags(s)

MRGSGPRGAGHRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNEVNLLDSRTVM
GDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKFTLRDCNSL
PGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLSKKGF
YLAFQDVGACIALVSVRVYYKKCPSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEG
EWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPP
TMACTRPPSAPRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKIAKNSISLSWQ
EPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQIRARTAAGYGVFSRRFEFETT
PVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCECGCGRASSLCAVAHPSLIWRCGYSKAKQDP
EEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKR
ELPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDG
QFTVIQLVGMLRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKI
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQL
MLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHSPLGSGAYRSVGEWLEAIKMG
RYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNSLQEMKVQLVNGMVPL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_004439
ORF Size 3111 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004439.4, NP_004430
RefSeq Size 3349
RefSeq ORF 3114
Locus ID 2044
Cytogenetics 4q13.1-q13.2
Domains pkinase, EPH_lbd, TyrKc, SAM, S_TKc, FN3
Protein Families Protein Kinase, Transmembrane, Druggable Genome
Protein Pathways Axon guidance
Gene Summary This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations