OGR1(GPR68) (NM_003485) Human Tagged ORF Clone

CAT#: RG212925

GPR68 (GFP-tagged) - Human G protein-coupled receptor 68 (GPR68), transcript variant 2

Change vector?

  • TrueORF®

USD 629.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name OGR1(GPR68) (NM_003485) Human Tagged ORF Clone
Symbol GPR68
Synonyms GPR12A; OGR1
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG212925 representing NM_003485
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGAGTGTGGCCCCTTCAGGCCCAAAGATGGGGAACATCACTGCAGACAACTCCTCGATGAGCTGTA
CCATCGACCATACCATCCACCAGACGCTGGCCCCGGTGGTCTATGTTACCGTGCTGGTGGTGGGCTTCCC
GGCCAACTGCCTGTCCCTCTACTTCGGCTACCTGCAGATCAAGGCCCGGAACGAGCTGGGCGTGTACCTG
TGCAACCTGACGGTGGCCGACCTCTTCTACATCTGCTCGCTGCCCTTCTGGCTGCAGTACGTGCTGCAGC
ACGACAACTGGTCTCACGGCGACCTGTCCTGCCAGGTGTGCGGCATCCTCCTGTACGAGAACATCTACAT
CAGCGTGGGCTTCCTCTGCTGCATCTCCGTGGACCGCTACCTGGCTGTGGCCCATCCCTTCCGCTTCCAC
CAGTTCCGGACCCTGAAGGCGGCCGTCGGCGTCAGCGTGGTCATCTGGGCCAAGGAGCTGCTGACCAGCA
TCTACTTCCTGATGCACGAGGAGGTCATCGAGGACGAGAACCAGCACCGCGTGTGCTTTGAGCACTACCC
CATCCAGGCATGGCAGCGCGCCATCAACTACTACCGCTTCCTGGTGGGCTTCCTCTTCCCCATCTGCCTG
CTGCTGGCGTCCTACCAGGGCATCCTGCGCGCCGTGCGCCGGAGCCACGGCACCCAGAAGAGCCGCAAGG
ACCAGATCCAGCGGCTGGTGCTCAGCACCGTGGTCATCTTCCTGGCCTGCTTCCTGCCCTACCACGTGTT
GCTGCTGGTGCGCAGCGTCTGGGAGGCCAGCTGCGACTTCGCCAAGGGCGTTTTCAACGCCTACCACTTC
TCCCTCCTGCTCACCAGCTTCAACTGCGTCGCCGACCCCGTGCTCTACTGCTTCGTCAGCGAGACCACCC
ACCGGGACCTGGCCCGCCTCCGCGGGGCCTGCCTGGCCTTCCTCACCTGCTCCAGGACCGGCCGGGCCAG
GGAGGCCTACCCGCTGGGTGCCCCCGAGGCCTCCGGGAAAAGCGGGGCCCAGGGTGAGGAGCCCGAGCTG
TTGACCAAGCTCCACCCGGCCTTCCAGACCCCTAACTCGCCAGGGTCGGGCGGGTTCCCCACGGGCAGGT
TGGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG212925 representing NM_003485
Red=Cloning site Green=Tags(s)

MRSVAPSGPKMGNITADNSSMSCTIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYL
CNLTVADLFYICSLPFWLQYVLQHDNWSHGDLSCQVCGILLYENIYISVGFLCCISVDRYLAVAHPFRFH
QFRTLKAAVGVSVVIWAKELLTSIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICL
LLASYQGILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSVWEASCDFAKGVFNAYHF
SLLLTSFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPEL
LTKLHPAFQTPNSPGSGGFPTGRLA

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_003485
ORF Size 1125 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003485.2, NP_003476
RefSeq Size 1523
Locus ID 8111
Cytogenetics 14q32.11
Protein Families GPCR, Transmembrane, Druggable Genome
Gene Summary The protein encoded by this gene is a G protein-coupled receptor for sphingosylphosphorylcholine. The encoded protein is a proton-sensing receptor, inactive at pH 7.8 but active at pH 6.8. Mutations in this gene are a cause of amelogenesis imperfecta. [provided by RefSeq, Feb 2017]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.