CEP104 (NM_014704) Human Tagged ORF Clone

CAT#: RG212710

Reviews ()
Write a review
  • TrueORF®

CEP104 (GFP-tagged) - Human centrosomal protein 104kDa (CEP104)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,276.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol CEP104
Synonyms CFAP256; GlyBP; JBTS25; KIAA0562; ROC22
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG212710 representing NM_014704
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCCACAAGATTGGATTTGTAGTCGTCAGCTCATCTGGACACGAAGACGGCTTCAGTGCCCGGGAGC
TCATGATCCACGCGCCAACTGTCAGTGGGTGGCGGTCACCTAGATTTTGCCAGTTTCCACAAGAAATTGT
CCTTCAAATGGTGGAGAGATGTCGAATAAGGAAACTGCAGTTACTTGCTCACCAGTATATGATTTCAAGT
AAAATTGAGTTCTACATTAGTGAAAGCTTGCCTGAATATTTTGCACCCTATCAAGCAGAGCGGTTTCGAA
GACTTGGCTACGTGTCTCTCTGTGATAATGAAAAGACAGGTTGCAAAGCCCGGGAACTAAAATCAGTTTA
TGTGGATGCAGTAGGACAATTTCTTAAACTGATTTTTCACCAAAACCATGTCAACAAATACAACATATAT
AATCAGGTTGCTTTGGTTGCCATAAATATCATTGGAGACCCTGCAGATTTCAGTGATGAAAGCAATACTG
CCTCTCGAGAGAAGTTGATTGACCACTACCTTGGGCACAACAGCGAGGACCCTGCTCTAGAAGGAACGTA
CGCCAGGAAATCTGACTATATCTCTCCGCTAGATGACTTAGCTTTTGATATGTACCAAGATCCAGAAGTT
GCACAGATCATACGAAAATTAGATGAAAGAAAACGGGAAGCTGTCCAAAAGGAACGCTATGATTATGCCA
AGAAACTAAAACAAGCCATTGCTGATTTGCAAAAGGTTGGTGAGCGCCTTGGGAGGTATGAGGTAGAGAA
ACGCTGTGCCGTGGAGAAGGAAGACTACGATCTCGCCAAGGAGAAGAAGCAGCAGATGGAGCAGTATCGT
GCCGAGGTGTACGAGCAGCTGGAGCTGCACAGCCTCCTGGATGCCGAGCTGATGCGAAGACCTTTTGATT
TGCCCCTCCAGCCCCTCGCTCGTTCTGGCAGTCCTTGCCACCAAAAGCCAATGCCCTCACTACCACAACT
GGAAGAAAGAGGAACAGAAAACCAGTTTGCAGAACCTTTCCTTCAGGAAAAGCCTTCATCATATTCTCTA
ACTATTTCTCCTCAGCATTCTGCAGTAGACCCGTTACTCCCTGCCACAGATCCTCATCCAAAGATCAATG
CAGAGTCCCTGCCCTACGATGAGCGGCCTCTTCCAGCTATTCGTAAGCATTATGGGGAGGCAGTGGTGGA
GCCGGAAATGAGTAATGCAGACATCAGCGATGCTCGGAGGGGAGGCATGTTAGGGGAGCCAGAGCCCTTA
ACCGAGAAGGCCTTGAGAGAAGCCAGCTCTGCCATCGATGTGTTGGGAGAAACCTTGGTTGCTGAGGCCT
ATTGTAAGACGTGGTCCTACCGAGAGGATGCACTGCTTGCCTTGTCTAAGAAGTTAATGGAAATGCCTGT
TGGAACCCCAAAAGAAGATTTAAAGAACACACTGAGAGCATCCGTCTTTCTCGTTAGAAGAGCCATAAAG
GACATTGTGACCTCCGTTTTTCAGGCTTCTTTGAAATTGTTGAAAATGATCATTACACAATATATTCCTA
AACATAAACTGAGTAAACTTGAAACAGCTCACTGTGTGGAGAGGACCATTCCCGTTTTGCTCACCAGAAC
TGGAGATTCTTCTGCCCGCCTCCGCGTCACAGCTGCAAATTTTATTCAGGAAATGGCCTTGTTTAAAGAA
GTTAAGTCTCTCCAAATTATTCCATCCTACCTGGTGCAGCCATTGAAAGCAAACTCTTCAGTTCACCTGG
CAATGAGTCAGATGGGCCTCCTGGCCCGGCTGCTGAAAGACCTGGGCACTGGCAGCTCGGGCTTCACCAT
TGACAACGTGATGAAGTTTTCAGTGAGTGCCCTGGAGCATAGAGTGTATGAGGTCCGCGAGACGGCGGTT
CGAATTATTTTGGACATGTACAGACAGCACCAGGCTTCCATCCTGGAGTACCTTCCTCCAGACGACAGCA
ACACACGCAGGAACATTCTCTACAAAACAATTTTTGAGGGATTTGCTAAAATAGATGGCAGAGCTACAGA
TGCTGAGATGAGGGCACGGAGAAAAGCGGCTACAGAAGAAGCAGAAAAACAAAAGAAAGAAGAAATAAAA
GCTTTACAAGGGCAGCTGGCAGCACTGAAAGAAATTCAGGCTGAAGTTCAGGAAAAAGAAAGTGATGCTG
TGAAGCCAAAGAATCAGGACATTCAAGGAGGGAAAGCAGCCCCTGCTGAAGCTCTGGGAATCCCGGATGA
GCACTATCTAGATAATTTGTGTATTTTTTGTGGGGAAAGGAGTGAATCCTTCACAGAGGAAGGTCTGGAT
CTCCACTACTGGAAGCACTGTCTCATGCTGACAAGATGTGACCACTGCAAACAGGTGGTCGAGATATCCA
GTCTGACGGAGCACTTGCTGACGGAATGTGACAAAAAAGACGGGTTTGGAAAGTGTTACCGTTGCAGTGA
GGCTGTTTTCAAGGAAGAGCTGCCCAGACACATAAAACACAAGGATTGCAACCCTGCCAAACCGGAGAAG
CTGGCAAACCGGTGTCCCCTGTGTCATGAGAACTTCAGCCCTGGAGAAGAGGCATGGAAAGCTCACCTGA
TGGGCCCAGCCGGCTGCACGATGAACCTGCGCAAGACACACATTCTGCAGAAGGCCCCGGCACTGCAGCC
AGGGAAAAGCTCAGCTGTGGCCGCATCAGGCCCCTTGGGGTCAAAGGCCGGAAGCAAGATCCCCACCCCG
AAGGGCGGACTGAGCAAGAGCTCCAGCAGGACGTACGCCAAGCGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG212710 representing NM_014704
Red=Cloning site Green=Tags(s)

MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQLLAHQYMISS
KIEFYISESLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLIFHQNHVNKYNIY
NQVALVAINIIGDPADFSDESNTASREKLIDHYLGHNSEDPALEGTYARKSDYISPLDDLAFDMYQDPEV
AQIIRKLDERKREAVQKERYDYAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMEQYR
AEVYEQLELHSLLDAELMRRPFDLPLQPLARSGSPCHQKPMPSLPQLEERGTENQFAEPFLQEKPSSYSL
TISPQHSAVDPLLPATDPHPKINAESLPYDERPLPAIRKHYGEAVVEPEMSNADISDARRGGMLGEPEPL
TEKALREASSAIDVLGETLVAEAYCKTWSYREDALLALSKKLMEMPVGTPKEDLKNTLRASVFLVRRAIK
DIVTSVFQASLKLLKMIITQYIPKHKLSKLETAHCVERTIPVLLTRTGDSSARLRVTAANFIQEMALFKE
VKSLQIIPSYLVQPLKANSSVHLAMSQMGLLARLLKDLGTGSSGFTIDNVMKFSVSALEHRVYEVRETAV
RIILDMYRQHQASILEYLPPDDSNTRRNILYKTIFEGFAKIDGRATDAEMRARRKAATEEAEKQKKEEIK
ALQGQLAALKEIQAEVQEKESDAVKPKNQDIQGGKAAPAEALGIPDEHYLDNLCIFCGERSESFTEEGLD
LHYWKHCLMLTRCDHCKQVVEISSLTEHLLTECDKKDGFGKCYRCSEAVFKEELPRHIKHKDCNPAKPEK
LANRCPLCHENFSPGEEAWKAHLMGPAGCTMNLRKTHILQKAPALQPGKSSAVAASGPLGSKAGSKIPTP
KGGLSKSSSRTYAKR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014704
ORF Size 2775 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014704.1, NP_055519.1
RefSeq Size 5848 bp
RefSeq ORF 2778 bp
Locus ID 9731
UniProt ID O60308
Cytogenetics 1p36.32
Gene Summary This gene encodes a centrosomal protein required for ciliogenesis and for ciliary tip structural integrity. The mammalian protein contains three amino-terminal hydrophobic domains, two glycosylation sites, four cysteine-rich motifs, and two regions with homology to the glutamate receptor ionotropic, NMDA 1 protein. During ciliogenesis, the encoded protein translocates from the distal tips of the centrioles to the tip of the elongating cilium. Knockdown of the protein in human retinal pigment cells results in severe defects in ciliogenesis with structural deformities at the ciliary tips. Allelic variants of this gene are associated with the autosomal-recessive disorder Joubert syndrome, which is characterized by a distinctive mid-hindbrain and cerebellar malformation, oculomotor apraxia, irregular breathing, developmental delay, and ataxia. [provided by RefSeq, Feb 2016]
Other products for "CEP104"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.