CHRNA3 (NM_000743) Human Tagged ORF Clone

CAT#: RG212582

CHRNA3 (GFP-tagged) - Human cholinergic receptor, nicotinic, alpha 3 (CHRNA3), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CHRNA3 (NM_000743) Human Tagged ORF Clone
Symbol CHRNA3
Synonyms LNCR2; NACHRA3; PAOD2
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG212582 representing NM_000743
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTCTGGCCCGCTCTCGCTGCCCCTGGCGCTGTCGCCGCCGCGGCTGCTGCTGCTGCTGCTGCTGT
CTCTGCTGCCAGTGGCCAGGGCCTCAGAGGCTGAGCACCGTCTATTTGAGCGGCTGTTTGAAGATTACAA
TGAGATCATCCGGCCTGTAGCCAACGTGTCTGACCCAGTCATCATCCATTTCGAGGTGTCCATGTCTCAG
CTGGTGAAGGTGGATGAAGTAAACCAGATCATGGAGACCAACCTGTGGCTCAAGCAAATCTGGAATGACT
ACAAGCTGAAGTGGAACCCCTCTGACTATGGTGGGGCAGAGTTCATGCGTGTCCCTGCACAGAAGATCTG
GAAGCCAGACATTGTGCTGTATAACAATGCTGTTGGGGATTTCCAGGTGGACGACAAGACCAAAGCCTTA
CTCAAGTACACTGGGGAGGTGACTTGGATACCTCCGGCCATCTTTAAGAGCTCCTGTAAAATCGACGTGA
CCTACTTCCCGTTTGATTACCAAAACTGTACCATGAAGTTCGGTTCCTGGTCCTACGATAAGGCGAAAAT
CGATCTGGTCCTGATCGGCTCTTCCATGAACCTCAAGGACTATTGGGAGAGCGGCGAGTGGGCCATCATC
AAAGCCCCAGGCTACAAACACGACATCAAGTACAACTGCTGCGAGGAGATCTACCCCGACATCACATACT
CGCTGTACATCCGGCGCCTGCCCTTGTTCTACACCATCAACCTCATCATCCCCTGCCTGCTCATCTCCTT
CCTCACTGTGCTCGTCTTCTACCTGCCCTCCGACTGCGGTGAGAAGGTGACCCTGTGCATTTCTGTCCTC
CTCTCCCTGACGGTGTTTCTCCTGGTGATCACTGAGACCATCCCTTCCACCTCGCTGGTCATCCCCCTGA
TTGGAGAGTACCTCCTGTTCACCATGATTTTTGTAACCTTGTCCATCGTCATCACCGTCTTCGTGCTCAA
CGTGCACTACAGAACCCCGACGACACACACAATGCCCTCATGGGTGAAGACTGTATTCTTGAACCTGCTC
CCCAGGGTCATGTTCATGACCAGGCCAACAAGCAACGAGGGCAACGCTCAGAAGCCGAGGCCCCTCTACG
GTGCCGAGCTCTCAAATCTGAATTGCTTCAGCCGCGCAGAGTCCAAAGGCTGCAAGGAGGGCTACCCCTG
CCAGGACGGGATGTGTGGTTACTGCCACCACCGCAGGATAAAAATCTCCAATTTCAGTGCTAACCTCACG
AGAAGCTCTAGTTCTGAATCTGTTGATGCTGTGCTGTCCCTCTCTGCTTTGTCACCAGAAATCAAAGAAG
CCATCCAAAGTGTCAAGTATATTGCTGAAAATATGAAAGCACAAAATGAAGCCAAAGAGATTCAAGATGA
TTGGAAGTATGTTGCCATGGTGATTGATCGTATTTTTCTGTGGGTTTTCACCCTGGTGTGCATTCTAGGG
ACAGCAGGATTGTTTCTGCAACCCCTGATGGCCAGGGAAGATGCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG212582 representing NM_000743
Red=Cloning site Green=Tags(s)

MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQ
LVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKAL
LKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAII
KAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVL
LSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLL
PRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILG
TAGLFLQPLMAREDA

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000743
ORF Size 1515 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000743.2, NP_000734
RefSeq Size 3020
RefSeq ORF 1518
Locus ID 1136
Cytogenetics 15q25.1
Protein Families Ion Channels: Cys-loop Receptors, Transmembrane, Druggable Genome
Gene Summary This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)