AMMECR1 (NM_015365) Human Tagged ORF Clone

CAT#: RG212378

AMMECR1 (GFP-tagged) - Human Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 (AMMECR1), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 464.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name AMMECR1 (NM_015365) Human Tagged ORF Clone
Symbol AMMECR1
Synonyms AMMERC1
Vector pCMV6-AC-GFP
Sequence Data
>RG212378 representing NM_015365
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGGTTGCTGCGGGGTGAAGAAGCAGAAACTGTCCAGTTCGCCCCCCTCTGGCTCGGGTGGCG
GTGGTGGCGCCTCCTCCTCCTCCCACTGCAGCGGAGAGAGCCAGTGCCGAGCTGGGGAGCTGGGACTAGG
AGGCGCCGGTACGCGGCTCAACGGGCTGGGAGGTCTAACCGGAGGAGGTAGCGGCAGCGGCTGTACCCTC
TCTCCCCCCCAGGGCTGCGGCGGCGGCGGCGGGGGGATCGCCCTGTCGCCACCTCCGAGCTGCGGAGTGG
GGACCCTACTTTCTACCCCGGCCGCCGCCACCTCTTCCTCACCCTCCTCATCGTCCGCCGCCTCGTCCTC
ATCGCCGGGCTCCCGGAAGATGGTGGTGTCAGCAGAGATGTGCTGCTTTTGCTTCGATGTGCTCTACTGT
CACCTGTATGGATACCAGCAGCCCCGGACCCCCCGATTCACCAACGAGCCCTACCCACTGTTTGTAACAT
GGAAGATTGGTCGAGACAAAAGATTACGTGGATGCATAGGTACTTTTTCTGCCATGAATTTGCATTCAGG
ACTCAGGGAGTACACACTTACCAGTGCCCTTAAAGATAGCCGTTTTCCCCCAATGACAAGGGATGAGCTG
CCACGGCTTTTCTGCTCAGTGTCTCTGCTCACTAACTTTGAAGATGTCTGTGATTATTTGGACTGGGAGG
TGGGTGTACATGGCATTAGAATAGAATTCATCAATGAAAAAGGATCAAAACGCACCGCCACCTACCTACC
GGAGGTTGCAAAGGAGCAAGGATGGGACCATATACAGACCATAGACTCCTTATTGAGGAAAGGAGGATAC
AAAGCTCCGATTACTAATGAATTCAGGAAAACCATAAAACTGACCAGGTATCGTAGTGAAAAGATGACCC
TGAGCTATGCTGAATACCTTGCTCATCGCCAGCATCATCATTTCCAAAATGGCATTGGGCATCCCCTTCC
GCCATACAACCATTATTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG212378 representing NM_015365
Red=Cloning site Green=Tags(s)

MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTL
SPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYC
HLYGYQQPRTPRFTNEPYPLFVTWKIGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFPPMTRDEL
PRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGY
KAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_015365
ORF Size 999 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015365.2, NP_056180
RefSeq Size 5431
RefSeq ORF 1002
Locus ID 9949
Cytogenetics Xq23
Protein Families Druggable Genome
Gene Summary The exact function of this gene is not known, however, submicroscopic deletion of the X chromosome including this gene, COL4A5, and FACL4 genes, result in a contiguous gene deletion syndrome, the AMME complex (Alport syndrome, mental retardation, midface hypoplasia, and elliptocytosis). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)