MUSK (NM_005592) Human Tagged ORF Clone

CAT#: RG212253

MUSK (GFP-tagged) - Human muscle, skeletal, receptor tyrosine kinase (MUSK), transcript variant 1

Change vector?

  • TrueORF®

USD 1,473


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name MUSK (NM_005592) Human Tagged ORF Clone
Symbol MUSK
Synonyms MGC126323; MGC126324
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG212253 representing NM_005592
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGAGAGCTCGTCAACATTCCACTGGTACATATTCTTACTCTGGTTGCCTTCAGCGGAACTGAGAAAC
TTCCAAAAGCTCCTGTCATCACCACTCCTCTTGAAACAGTGGATGCCTTAGTTGAAGAAGTGGCTACTTT
CATGTGTGCAGTGGAATCCTACCCCCAGCCTGAGATTTCCTGGACTAGAAATAAAATTCTCATTAAACTC
TTTGACACCCGGTACAGCATCCGGGAGAATGGGCAGCTCCTCACCATCCTGAGTGTGGAAGACAGTGATG
ATGGCATTTACTGCTGCACGGCCAACAATGGTGTGGGAGGAGCTGTGGAGAGTTGTGGAGCCCTGCAAGT
GAAGATGAAACCTAAAATAACTCGTCCTCCCATAAATGTGAAAATAATAGAGGGATTAAAAGCAGTCCTA
CCATGTACTACAATGGGTAATCCCAAACCATCAGTGTCTTGGATAAAGGGAGACAGCCCTCTCAGGGAAA
ATTCCCGAATTGCAGTTCTTGAATCTGGGAGCTTGAGGATTCATAACGTACAAAAGGAAGATGCAGGACA
GTATCGATGTGTGGCAAAAAACAGCCTCGGGACAGCATATTCCAAAGTGGTGAAGCTGGAAGTTGAGGTT
TTTGCCAGGATCCTGCGGGCTCCTGAATCCCACAATGTCACCTTTGGCTCCTTTGTGACCCTGCACTGTA
CAGCAACAGGCATTCCTGTCCCCACCATCACCTGGATTGAAAACGGAAATGCTGTTTCTTCTGGGTCCAT
TCAAGAGAGTGTGAAAGACCGAGTGATTGACTCAAGACTGCAGCTGTTTATCACCAAGCCAGGACTCTAC
ACATGCATAGCTACCAATAAGCATGGGGAGAAGTTCAGTACTGCCAAGGCTGCAGCCACCATCAGCATAG
CAGAATGGAGTAAACCACAGAAAGATAACAAAGGCTACTGCGCCCAGTACAGAGGGGAGGTGTGTAATGC
AGTCCTGGCAAAAGATGCTCTTGTTTTTCTCAACACCTCCTATGCGGACCCTGAGGAGGCCCAAGAGCTA
CTGGTCCACACGGCCTGGAATGAACTGAAAGTAGTGAGCCCAGTCTGCCGGCCAGCTGCTGAGGCTTTGT
TGTGTAACCACATCTTCCAGGAGTGCAGTCCTGGAGTAGTGCCTACTCCTATTCCCATTTGCAGAGAGTA
CTGCTTGGCAGTAAAGGAGCTCTTCTGCGCAAAAGAATGGCTGGTAATGGAAGAGAAGACCCACAGAGGA
CTCTACAGATCCGAGATGCATTTGCTGTCCGTGCCAGAATGCAGCAAGCTTCCCAGCATGCATTGGGACC
CCACGGCCTGTGCCAGACTGCCACATCTAGATTATAACAAAGAAAACCTAAAAACATTCCCACCAATGAC
GTCCTCAAAGCCAAGTGTGGACATTCCAAATCTGCCTTCCTCCTCCTCTTCTTCCTTCTCTGTCTCACCT
ACATACTCCATGACTGTAATAATCTCCATCATGTCCAGCTTTGCAATATTTGTGCTTCTTACCATAACTA
CTCTCTATTGCTGCCGAAGAAGAAAACAATGGAAAAATAAGAAAAGAGAATCAGCAGCAGTAACCCTCAC
CACACTGCCTTCTGAGCTCTTACTAGATAGACTTCATCCCAACCCCATGTACCAGAGGATGCCGCTCCTT
CTGAACCCCAAATTGCTCAGCCTGGAGTATCCAAGGAATAACATTGAATATGTGAGAGACATCGGAGAGG
GAGCGTTTGGAAGGGTGTTTCAAGCAAGGGCACCAGGCTTACTTCCCTATGAACCTTTCACTATGGTGGC
AGTAAAGATGCTCAAAGAAGAAGCCTCGGCAGATATGCAAGCGGACTTTCAGAGGGAGGCAGCCCTCATG
GCAGAATTTGACAACCCTAACATTGTGAAGCTATTAGGAGTGTGTGCTGTCGGGAAGCCAATGTGCCTGC
TCTTTGAATACATGGCCTATGGTGACCTCAATGAGTTCCTCCGCAGCATGTCCCCTCACACCGTGTGCAG
CCTCAGTCACAGTGACTTGTCTATGAGGGCTCAGGTCTCCAGCCCTGGGCCCCCACCCCTCTCCTGTGCT
GAGCAGCTTTGCATTGCCAGGCAGGTGGCAGCTGGCATGGCTTACCTCTCAGAACGTAAGTTTGTTCACC
GAGATTTAGCCACCAGGAACTGCCTGGTGGGCGAGAACATGGTGGTGAAAATTGCCGACTTTGGCCTCTC
CAGGAACATCTACTCAGCAGACTACTACAAAGCTAATGAAAACGACGCTATCCCTATCCGTTGGATGCCA
CCAGAGTCCATTTTTTATAACCGCTACACTACAGAGTCTGATGTGTGGGCCTATGGCGTGGTCCTCTGGG
AGATCTTCTCCTATGGCCTGCAGCCCTACTATGGGATGGCCCATGAGGAGGTCATTTACTACGTGCGAGA
TGGCAACATCCTCTCCTGCCCTGAGAACTGCCCCGTGGAGCTGTACAATCTCATGCGTCTATGTTGGAGC
AAGCTGCCTGCAGACAGACCCAGTTTCACCAGTATTCACCGAATTCTGGAACGCATGTGTGAGAGGGCAG
AGGGAACTGTGAGTGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG212253 representing NM_005592
Red=Cloning site Green=Tags(s)

MRELVNIPLVHILTLVAFSGTEKLPKAPVITTPLETVDALVEEVATFMCAVESYPQPEISWTRNKILIKL
FDTRYSIRENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMKPKITRPPINVKIIEGLKAVL
PCTTMGNPKPSVSWIKGDSPLRENSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKVVKLEVEV
FARILRAPESHNVTFGSFVTLHCTATGIPVPTITWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLY
TCIATNKHGEKFSTAKAAATISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQEL
LVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLAVKELFCAKEWLVMEEKTHRG
LYRSEMHLLSVPECSKLPSMHWDPTACARLPHLDYNKENLKTFPPMTSSKPSVDIPNLPSSSSSSFSVSP
TYSMTVIISIMSSFAIFVLLTITTLYCCRRRKQWKNKKRESAAVTLTTLPSELLLDRLHPNPMYQRMPLL
LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALM
AEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPPLSCA
EQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMP
PESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWS
KLPADRPSFTSIHRILERMCERAEGTVSV

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005592
ORF Size 2607 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005592.1, NP_005583
RefSeq Size 2666
RefSeq ORF 2610
Locus ID 4593
Cytogenetics 9q31.3
Protein Families Protein Kinase, Transmembrane, Druggable Genome
Gene Summary This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described.[provided by RefSeq, Oct 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.