ARNT2 (NM_014862) Human Tagged ORF Clone

CAT#: RG211966

Reviews ()
Write a review
  • TrueORF®

ARNT2 (GFP-tagged) - Human aryl-hydrocarbon receptor nuclear translocator 2 (ARNT2)



  "NM_014862" in other vectors (4)

USD 670.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ARNT2 (NM_014862) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ARNT2
Synonyms bHLHe1; WEDAS
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG211966 representing NM_014862
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAACCCCGGCGGCGGTCAACCCTCCGGAAATGGCTTCAGACATACCTGGATCTGTGACGTTGCCCG
TTGCCCCCATGGCGGCCACCGGACAGGTGAGGATGGCGGGGGCCATGCCTGCCCGTGGAGGAAAGCGGCG
TTCCGGAATGGACTTCGATGATGAAGATGGTGAAGGCCCCAGTAAATTTTCAAGAGAGAATCATAGTGAA
ATCGAAAGGCGCAGACGGAACAAGATGACTCAGTACATCACGGAGCTCTCCGACATGGTCCCCACATGCA
GCGCACTGGCTCGGAAGCCAGACAAGCTCACCATCCTCCGCATGGCCGTCTCGCACATGAAGTCCATGAG
GGGTACAGGGAACAAGTCCACCGATGGCGCGTACAAGCCTTCCTTCCTCACAGAGCAGGAACTGAAGCAT
CTCATCCTTGAAGCAGCTGATGGATTTCTGTTTGTGGTGGCTGCTGAGACAGGGCGAGTGATTTATGTGT
CTGACTCCGTCACCCCTGTTCTGAACCAGCCCCAGTCAGAGTGGTTTGGGAGCACACTGTATGAACAGGT
GCATCCTGATGACGTGGAGAAGCTGAGAGAGCAACTGTGCACCTCAGAAAACTCAATGACAGGCCGGATC
TTGGACCTGAAGACTGGGACGGTCAAGAAAGAAGGGCAGCAGTCATCCATGAGGATGTGCATGGGCTCGC
GGCGGTCTTTCATCTGCAGGATGAGGTGTGGAAATGCTCCTTTGGACCACCTTCCTCTAAACAGAATAAC
CACCATGAGGAAAAGGTTCAGGAATGGCCTTGGCCCTGTGAAAGAAGGAGAAGCCCAATATGCTGTGGTC
CACTGTACAGGATACATCAAGGCCTGGCCACCAGCAGGAATGACCATACCTGAAGAAGACGCTGATGTGG
GACAAGGCAGTAAATATTGCCTCGTGGCAATTGGGAGACTCCAGGTGACCAGCTCTCCTGTATGCATGGA
CATGAATGGGATGTCGGTGCCCACAGAGTTCTTATCCCGGCATAACTCCGATGGAATCATCACATTTGTG
GATCCAAGATGTATCAGTGTGATTGGCTACCAACCCCAGGATCTTCTGGGAAAGGACATTTTGGAATTCT
GCCACCCTGAGGATCAAAGCCATCTGCGTGAGAGCTTCCAGCAGGTGGTTAAGCTGAAAGGCCAAGTCCT
GTCGGTCATGTATCGATTTCGCACCAAGAACCGGGAGTGGATGTTGATCCGCACCAGCAGCTTCACATTC
CAGAATCCCTATTCTGATGAGATTGAGTACATCATCTGCACCAACACCAACGTCAAGCAACTTCAGCAAC
AGCAGGCAGAATTGGAAGTGCACCAGAGAGATGGATTGTCATCGTATGACTTATCCCAGGTCCCCGTCCC
CAACCTACCAGCCGGTGTTCATGAGGCCGGGAAGTCCGTGGAAAAGGCGGATGCAATCTTCTCCCAGGAA
AGAGATCCTCGGTTTGCTGAAATGTTTGCAGGAATTAGTGCATCGGAGAAGAAGATGATGAGCTCAGCCT
CTGCAGCAGGAACCCAGCAGATCTACTCCCAAGGAAGCCCATTTCCCTCTGGACACTCCGGGAAGGCCTT
CAGCTCTTCAGTGGTTCATGTGCCTGGAGTGAATGATATTCAGTCCTCTTCTTCCACGGGCCAGAACATG
TCCCAAATCTCCCGGCAGCTAAACCAGAGTCAGGTGGCATGGACAGGGAGTCGTCCGCCCTTTCCGGGAC
AGCAAATCCCATCTCAGTCCAGCAAGACTCAGTCATCTCCCTTTGGGATTGGAACGAGCCACACCTACCC
GGCAGACCCCTCTTCCTACAGCCCCCTCTCCAGCCCAGCTACCTCCTCGCCAAGTGGGAATGCCTACTCC
AGTCTTGCCAACAGGACTCCAGGGTTCGCTGAAAGTGGACAAAGTAGCGGGCAGTTCCAAGGGCGGCCCT
CGGAAGTCTGGTCGCAGTGGCAAAGCCAGCACCATGGCCAGCAGAGCGGTGAGCAGCACTCCCACCAGCA
GCCCGGTCAGACTGAAGTGTTCCAGGACATGCTGCCCATGCCAGGAGATCCAACCCAGGGGACTGGCAAC
TATAACATCGAAGACTTTGCCGACCTGGGCATGTTTCCACCGTTTTCTGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG211966 representing NM_014862
Red=Cloning site Green=Tags(s)

MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSE
IERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPSFLTEQELKH
LILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGRI
LDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVV
HCTGYIKAWPPAGMTIPEEDADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFV
DPRCISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQE
RDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNM
SQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYS
SLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGN
YNIEDFADLGMFPPFSE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_014862
ORF Size 2151 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014862.3, NP_055677.3
RefSeq Size 6576 bp
RefSeq ORF 2154 bp
Locus ID 9915
Cytogenetics 15q25.1
Domains PAS, HLH, PAC
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Renal cell carcinoma
Gene Summary This gene encodes a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. The encoded protein acts as a partner for several sensor proteins of the bHLH-PAS family, forming heterodimers with the sensor proteins that bind regulatory DNA sequences in genes responsive to developmental and environmental stimuli. Under hypoxic conditions, the encoded protein complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. A highly similar protein in mouse forms functional complexes with both aryl hydrocarbon receptors and Single-minded proteins, suggesting additional roles for the encoded protein in the metabolism of xenobiotic compounds and the regulation of neurogenesis, respectively. [provided by RefSeq, Dec 2013]

Citations (1)

Other Versions

Other products for "ARNT2"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit polyclonal ARNT2 Antibody (Center)
    • 400 ul

USD 450.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools