MITF (NM_198159) Human Tagged ORF Clone

CAT#: RG211518

MITF (GFP-tagged) - Human microphthalmia-associated transcription factor (MITF), transcript variant 1

Change vector?

  • TrueORF®

USD 721


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name MITF (NM_198159) Human Tagged ORF Clone
Symbol MITF
Synonyms bHLHe32; CMM8; MI; WS2; WS2A
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG211518 representing NM_198159
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTCCGAATCGGGGATCGTGCCGGATTTCGAAGTCGGGGAGGAGTTTCATGAAGAGCCCAAAACCT
ATTACGAACTCAAAAGTCAACCGCTGAAGAGCAGCAGTTCCGCCGAGCATCCTGGGGCCTCCAAGCCTCC
GATAAGCTCCTCCAGTATGACATCACGCATCTTGCTACGCCAGCAACTCATGCGTGAGCAGATGCAGGAG
CAGGAGCGCAGGGAGCAGCAGCAGAAGCTGCAGGCGGCCCAGTTCATGCAACAGAGAGTGCCCGTGAGTC
AGACACCAGCCATAAACGTCAGTGTGCCCACCACCCTTCCCTCTGCCACGCAGGTGCCGATGGAAGTCCT
TAAGGTGCAGACCCACCTCGAAAACCCCACCAAGTACCACATACAGCAAGCCCAACGGCAGCAGGTAAAG
CAGTACCTTTCTACCACTTTAGCAAATAAACATGCCAACCAAGTCCTGAGCTTGCCATGTCCAAACCAGC
CTGGCGATCATGTCATGCCACCGGTGCCGGGGAGCAGCGCACCCAACAGCCCCATGGCTATGCTTACGCT
TAACTCCAACTGTGAAAAAGAGGGATTTTATAAGTTTGAAGAGCAAAACAGGGCAGAGAGCGAGTGCCCA
GGCATGAACACACATTCACGAGCGTCCTGTATGCAGATGGATGATGTAATCGATGACATCATTAGCCTAG
AATCAAGTTATAATGAGGAAATCTTGGGCTTGATGGATCCTGCTTTGCAAATGGCAAATACGTTGCCTGT
CTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGGCCTCACCATCAGCAACTCC
TGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAGA
GGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGA
ACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCA
TCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGA
AACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGG
ACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCC
GTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATC
TCACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGT
CCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACT
GATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAGTATGAGCATGG
AAGAGACGGAGCACACTTGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG211518 representing NM_198159
Red=Cloning site Green=Tags(s)

MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLRQQLMREQMQE
QERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQTHLENPTKYHIQQAQRQQVK
QYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFEEQNRAESECP
GMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNS
CPANLPNIKRELTESEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKA
SVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEP
VLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVT
DPLLSSVSPGASKTSSRRSSMSMEETEHTC

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_198159
ORF Size 1560 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_198159.1, NP_937802
RefSeq Size 4788
RefSeq ORF 1563
Locus ID 4286
Cytogenetics 3p13
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Melanogenesis, Pathways in cancer, Melanoma
Gene Summary This gene encodes a transcription factor that contains both basic helix-loop-helix and leucine zipper structural features. It regulates the differentiation and development of melanocytes retinal pigment epithelium and is also responsible for pigment cell-specific transcription of the melanogenesis enzyme genes. Heterozygous mutations in the this gene cause auditory-pigmentary syndromes, such as Waardenburg syndrome type 2 and Tietz syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.