FLT3(FLT3) (NM_004119) Human Tagged ORF Clone

CAT#: RG211459

FLT3 (GFP-tagged) - Human fms-related tyrosine kinase 3 (FLT3)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FLT3(FLT3) (NM_004119) Human Tagged ORF Clone
Symbol FLT3
Synonyms CD135; FLK-2; FLK2; STK1
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG211459 representing NM_004119
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGCGTTGGCGCGCGGCGGCGGCCAGCTGCCGCTGCTCGTTGTTTTTTCTGCAATGATATTTGGGA
CTATTACAAATCAAGATCTGCCTGTGATCAAGTGTGTTTTAATCAATCATAAGAACAATGATTCATCAGT
GGGGAAGTCATCATCATATCCCATGGTATCAGAATCCCCGGAAGACCTCGGGTGTGCGTTGAGACCCCAG
AGCTCAGGGACAGTGTACGAAGCTGCCGCTGTGGAAGTGGATGTATCTGCTTCCATCACACTGCAAGTGC
TGGTCGATGCCCCAGGGAACATTTCCTGTCTCTGGGTCTTTAAGCACAGCTCCCTGAATTGCCAGCCACA
TTTTGATTTACAAAACAGAGGAGTTGTTTCCATGGTCATTTTGAAAATGACAGAAACCCAAGCTGGAGAA
TACCTACTTTTTATTCAGAGTGAAGCTACCAATTACACAATATTGTTTACAGTGAGTATAAGAAATACCC
TGCTTTACACATTAAGAAGACCTTACTTTAGAAAAATGGAAAACCAGGACGCCCTGGTCTGCATATCTGA
GAGCGTTCCAGAGCCGATCGTGGAATGGGTGCTTTGCGATTCACAGGGGGAAAGCTGTAAAGAAGAAAGT
CCAGCTGTTGTTAAAAAGGAGGAAAAAGTGCTTCATGAATTATTTGGGATGGACATAAGGTGCTGTGCCA
GAAATGAACTGGGCAGGGAATGCACCAGGCTGTTCACAATAGATCTAAATCAAACTCCTCAGACCACATT
GCCACAATTATTTCTTAAAGTAGGGGAACCCTTATGGATAAGGTGCAAAGCTGTTCATGTGAACCATGGA
TTCGGGCTCACCTGGGAATTAGAAAACAAAGCACTCGAGGAGGGCAACTACTTTGAGATGAGTACCTATT
CAACAAACAGAACTATGATACGGATTCTGTTTGCTTTTGTATCATCAGTGGCAAGAAACGACACCGGATA
CTACACTTGTTCCTCTTCAAAGCATCCCAGTCAATCAGCTTTGGTTACCATCGTAGAAAAGGGATTTATA
AATGCTACCAATTCAAGTGAAGATTATGAAATTGACCAATATGAAGAGTTTTGTTTTTCTGTCAGGTTTA
AAGCCTACCCACAAATCAGATGTACGTGGACCTTCTCTCGAAAATCATTTCCTTGTGAGCAAAAGGGTCT
TGATAACGGATACAGCATATCCAAGTTTTGCAATCATAAGCACCAGCCAGGAGAATATATATTCCATGCA
GAAAATGATGATGCCCAATTTACCAAAATGTTCACGCTGAATATAAGAAGGAAACCTCAAGTGCTCGCAG
AAGCATCGGCAAGTCAGGCGTCCTGTTTCTCGGATGGATACCCATTACCATCTTGGACCTGGAAGAAGTG
TTCAGACAAGTCTCCCAACTGCACAGAAGAGATCACAGAAGGAGTCTGGAATAGAAAGGCTAACAGAAAA
GTGTTTGGACAGTGGGTGTCGAGCAGTACTCTAAACATGAGTGAAGCCATAAAAGGGTTCCTGGTCAAGT
GCTGTGCATACAATTCCCTTGGCACATCTTGTGAGACGATCCTTTTAAACTCTCCAGGCCCCTTCCCTTT
CATCCAAGACAACATCTCATTCTATGCAACAATTGGTGTTTGTCTCCTCTTCATTGTCGTTTTAACCCTG
CTAATTTGTCACAAGTACAAAAAGCAATTTAGGTATGAAAGCCAGCTACAGATGGTACAGGTGACCGGCT
CCTCAGATAATGAGTACTTCTACGTTGATTTCAGAGAATATGAATATGATCTCAAATGGGAGTTTCCAAG
AGAAAATTTAGAGTTTGGGAAGGTACTAGGATCAGGTGCTTTTGGAAAAGTGATGAACGCAACAGCTTAT
GGAATTAGCAAAACAGGAGTCTCAATCCAGGTTGCCGTCAAAATGCTGAAAGAAAAAGCAGACAGCTCTG
AAAGAGAGGCACTCATGTCAGAACTCAAGATGATGACCCAGCTGGGAAGCCACGAGAATATTGTGAACCT
GCTGGGGGCGTGCACACTGTCAGGACCAATTTACTTGATTTTTGAATACTGTTGCTATGGTGATCTTCTC
AACTATCTAAGAAGTAAAAGAGAAAAATTTCACAGGACTTGGACAGAGATTTTCAAGGAACACAATTTCA
GTTTTTACCCCACTTTCCAATCACATCCAAATTCCAGCATGCCTGGTTCAAGAGAAGTTCAGATACACCC
GGACTCGGATCAAATCTCAGGGCTTCATGGGAATTCATTTCACTCTGAAGATGAAATTGAATATGAAAAC
CAAAAAAGGCTGGAAGAAGAGGAGGACTTGAATGTGCTTACATTTGAAGATCTTCTTTGCTTTGCATATC
AAGTTGCCAAAGGAATGGAATTTCTGGAATTTAAGTCGTGTGTTCACAGAGACCTGGCCGCCAGGAACGT
GCTTGTCACCCACGGGAAAGTGGTGAAGATATGTGACTTTGGATTGGCTCGAGATATCATGAGTGATTCC
AACTATGTTGTCAGGGGCAATGCCCGTCTGCCTGTAAAATGGATGGCCCCCGAAAGCCTGTTTGAAGGCA
TCTACACCATTAAGAGTGATGTCTGGTCATATGGAATATTACTGTGGGAAATCTTCTCACTTGGTGTGAA
TCCTTACCCTGGCATTCCGGTTGATGCTAACTTCTACAAACTGATTCAAAATGGATTTAAAATGGATCAG
CCATTTTATGCTACAGAAGAAATATACATTATAATGCAATCCTGCTGGGCTTTTGACTCAAGGAAACGGC
CATCCTTCCCTAATTTGACTTCGTTTTTAGGATGTCAGCTGGCAGATGCAGAAGAAGCGATGTATCAGAA
TGTGGATGGCCGTGTTTCGGAATGTCCTCACACCTACCAAAACAGGCGACCTTTCAGCAGAGAGATGGAT
TTGGGGCTACTCTCTCCGCAGGCTCAGGTCGAAGATTCG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG211459 representing NM_004119
Red=Cloning site Green=Tags(s)

MPALARGGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQ
SSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGE
YLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVPEPIVEWVLCDSQGESCKEES
PAVVKKEEKVLHELFGMDIRCCARNELGRECTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHG
FGLTWELENKALEEGNYFEMSTYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFI
NATNSSEDYEIDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITEGVWNRKANRK
VFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQDNISFYATIGVCLLFIVVLTL
LICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYDLKWEFPRENLEFGKVLGSGAFGKVMNATAY
GISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLL
NYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYEN
QKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQNGFKMDQ
PFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMD
LGLLSPQAQVEDS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_004119
ORF Size 2979 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004119.1, NP_004110
RefSeq Size 3475
RefSeq ORF 2982
Locus ID 2322
Cytogenetics 13q12.2
Protein Families Protein Kinase, ES Cell Differentiation/IPS, Transmembrane, Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Pathways in cancer, Acute myeloid leukemia
Gene Summary This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. This receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia. [provided by RefSeq, Jan 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.