EGR3 (NM_004430) Human Tagged ORF Clone

CAT#: RG211140

EGR3 (GFP-tagged) - Human early growth response 3 (EGR3), transcript variant 1

Change vector?

  • TrueORF®

USD 629


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EGR3 (NM_004430) Human Tagged ORF Clone
Symbol EGR3
Synonyms EGR-3; PILOT
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG211140 representing NM_004430
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGGCAAACTCGCCGAGAAGCTGCCGGTGACCATGAGCAGTTTGCTAAACCAACTGCCTGACAATC
TGTACCCCGAGGAGATCCCCAGCGCGCTCAACCTCTTCTCCGGCAGCAGCGACTCGGTAGTCCATTACAA
TCAGATGGCTACAGAGAATGTAATGGACATCGGTCTGACCAACGAGAAGCCCAACCCGGAACTCTCTTAC
TCCGGCTCCTTCCAGCCAGCCCCCGGCAACAAGACCGTGACCTACTTGGGAAAGTTCGCCTTCGACTCCC
CTTCCAACTGGTGCCAGGACAACATCATTAGCCTCATGAGCGCCGGCATCTTGGGGGTGCCCCCGGCTTC
AGGGGCGCTCAGCACGCAGACGTCCACGGCCAGCATGGTGCAGCCACCGCAGGGTGACGTGGAGGCCATG
TATCCCGCGCTACCCCCCTACTCCAACTGCGGCGACCTCTACTCAGAGCCCGTGTCTTTCCACGACCCCC
AGGGCAATCCCGGGCTCGCCTATTCCCCCCAGGATTACCAATCGGCCAAGCCGGCGTTGGACAGCAATCT
CTTCCCCATGATTCCTGACTACAACCTCTACCACCACCCCAACGACATGGGCTCCATTCCGGAGCACAAG
CCCTTCCAGGGCATGGACCCCATCCGGGTCAACCCGCCCCCTATTACCCCTCTGGAGACCATCAAGGCAT
TCAAAGACAAGCAGATCCACCCGGGCTTTGGCAGCCTGCCCCAGCCGCCGCTCACCCTCAAGCCCATCCG
GCCCCGCAAGTACCCCAACCGGCCTAGCAAGACACCGCTCCACGAACGGCCCCACGCGTGCCCGGCCGAG
GGCTGCGACCGCCGTTTCAGCCGTTCGGACGAGCTGACCCGGCACCTGCGCATCCACACGGGCCACAAGC
CCTTCCAGTGCCGGATCTGCATGCGGAGCTTCAGCCGCAGCGACCACCTCACCACTCACATCCGCACTCA
TACGGGCGAGAAGCCCTTTGCCTGCGAGTTCTGCGGGCGCAAGTTTGCGCGCAGCGACGAGCGCAAGCGC
CACGCCAAGATCCACCTCAAGCAAAAGGAGAAGAAGGCGGAGAAGGGCGGTGCACCCTCTGCATCCTCGG
CGCCCCCCGTGTCGCTGGCCCCCGTGGTCACCACCTGCGCC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG211140 representing NM_004430
Red=Cloning site Green=Tags(s)

MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSY
SGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAM
YPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHK
PFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAE
GCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKR
HAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_004430
ORF Size 1161 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004430.2, NP_004421
RefSeq Size 4342
RefSeq ORF 1164
Locus ID 1960
Cytogenetics 8p21.3
Gene Summary This gene encodes a transcriptional regulator that belongs to the EGR family of C2H2-type zinc-finger proteins. It is an immediate-early growth response gene which is induced by mitogenic stimulation. The protein encoded by this gene participates in the transcriptional regulation of genes in controling biological rhythm. It may also play a role in a wide variety of processes including muscle development, lymphocyte development, endothelial cell growth and migration, and neuronal development. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Dec 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations