ERAS (NM_181532) Human Tagged ORF Clone

CAT#: RG210965

ERAS (GFP-tagged) - Human ES cell expressed Ras (ERAS)

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ERAS (NM_181532) Human Tagged ORF Clone
Symbol ERAS
Synonyms HRAS2; HRASP
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG210965 representing NM_181532
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGCCAACAAAGCCTGGCACCTTCGACCTGGGCCTGGCCACATGGAGCCCTTCCTTCCAGGGGG
AAACCCACCGGGCTCAGGCACGCCGCAGGGATGTTGGCAGGCAGCTGCCTGAGTACAAGGCTGTGGTGGT
GGGCGCCAGTGGCGTGGGCAAGAGTGCGCTGACCATCCAGCTGAACCACCAGTGCTTCGTGGAGGACCAC
GACCCCACCATCCAGGATTCCTACTGGAAGGAGTTGACCCTGGACAGTGGGGACTGCATTCTGAATGTGC
TGGACACAGCAGGGCAGGCCATCCATAGGGCCCTGCGTGACCAGTGCCTGGCTGTCTGTGATGGTGTGCT
GGGCGTCTTCGCTCTCGATGACCCCTCGTCTCTGATCCAGCTGCAGCAGATATGGGCCACCTGGGGCCCT
CACCCCGCCCAGCCCCTTGTCCTCGTGGGCAACAAGTGTGACCTTGTGACCACTGCTGGAGATGCTCATG
CCGCTGCTGCAGCCCTCGCACACAGCTGGGGGGCCCACTTCGTGGAGACCTCGGCCAAAACACGGCAAGG
CGTGGAGGAGGCCTTTTCCCTGCTGGTCCATGAGATCCAGAGGGTCCAGGAGGCCATGGCGAAGGAGCCC
ATGGCAAGGTCCTGTAGGGAGAAGACCCGGCACCAGAAGGCCACCTGCCACTGTGGCTGCTCTGTGGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210965 representing NM_181532
Red=Cloning site Green=Tags(s)

MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDH
DPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGP
HPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEP
MARSCREKTRHQKATCHCGCSVA

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_181532
ORF Size 699 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_181532.2, NP_853510
RefSeq Size 1266
RefSeq ORF 702
Locus ID 3266
Cytogenetics Xp11.23
Protein Families Druggable Genome
Gene Summary This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. [provided by RefSeq, Dec 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations