Gastric Inhibitory Polypeptide Receptor(GIPR) (NM_000164) Human Tagged ORF Clone

CAT#: RG210811

GIPR (GFP-tagged) - Human gastric inhibitory polypeptide receptor (GIPR)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gastric Inhibitory Polypeptide Receptor(GIPR) (NM_000164) Human Tagged ORF Clone
Symbol GIPR
Synonyms PGQTL2
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG210811 representing NM_000164
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTACCTCTCCGATCCTGCAGCTGCTGCTGCGGCTCTCACTGTGCGGGCTGCTGCTCCAGAGGGCGG
AGACAGGCTCTAAGGGGCAGACGGCGGGGGAGCTGTACCAGCGCTGGGAACGGTACCGCAGGGAGTGCCA
GGAGACCTTGGCAGCCGCGGAACCGCCTTCAGGCCTCGCCTGTAACGGGTCCTTCGATATGTACGTCTGC
TGGGACTATGCTGCACCCAATGCCACTGCCCGTGCGTCCTGCCCCTGGTACCTGCCCTGGCACCACCATG
TGGCTGCAGGTTTCGTCCTCCGCCAGTGTGGCAGTGATGGCCAATGGGGACTTTGGAGAGACCATACACA
ATGTGAGAACCCAGAGAAGAATGAGGCCTTTCTGGACCAAAGGCTCATCTTGGAGCGGTTGCAGGTCATG
TACACTGTCGGCTACTCCCTGTCTCTCGCCACACTGCTGCTAGCCCTGCTCATCTTGAGTTTGTTCAGGC
GGCTACATTGCACTAGAAACTATATCCACATCAACCTGTTCACGTCTTTCATGCTGCGAGCTGCGGCCAT
TCTCAGCCGAGACCGTCTGCTACCTCGACCTGGCCCCTACCTTGGGGACCAGGCCCTTGCGCTGTGGAAC
CAGGCCCTCGCTGCCTGCCGCACGGCCCAGATCGTGACCCAGTACTGCGTGGGTGCCAACTACACGTGGC
TGCTGGTGGAGGGCGTCTACCTGCACAGTCTCCTGGTGCTCGTGGGAGGCTCCGAGGAGGGCCACTTCCG
CTACTACCTGCTCCTCGGCTGGGGGGCCCCCGCGCTTTTCGTCATTCCCTGGGTGATCGTCAGGTACCTG
TACGAGAACACGCAGTGCTGGGAGCGCAACGAAGTCAAGGCCATTTGGTGGATTATACGGACCCCCATCC
TCATGACCATCTTGATTAATTTCCTCATTTTTATCCGCATTCTTGGCATTCTCCTGTCCAAGCTGAGGAC
ACGGCAAATGCGCTGCCGGGATTACCGGCTGAGGCTGGCTCGCTCCACGCTGACGCTGGTGCCCCTGCTG
GGTGTCCACGAGGTGGTGTTTGCTCCCGTGACAGAGGAACAGGCCCGGGGCGCCCTGCGCTTCGCCAAGC
TCGGCTTTGAGATCTTCCTCAGCTCCTTCCAGGGCTTCCTGGTCAGCGTCCTCTACTGCTTCATCAACAA
GGAGGTGCAGTCGGAGATCCGCCGTGGCTGGCACCACTGCCGCCTGCGCCGCAGCCTGGGCGAGGAGCAA
CGCCAGCTCCCGGAGCGCGCCTTCCGGGCCCTGCCCTCCGGCTCCGGCCCGGGCGAGGTCCCCACCAGCC
GCGGCTTGTCCTCGGGGACCCTCCCAGGGCCTGGGAATGAGGCCAGCCGGGAGTTGGAAAGTTACTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210811 representing NM_000164
Red=Cloning site Green=Tags(s)

MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVC
WDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVM
YTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDRLLPRPGPYLGDQALALWN
QALAACRTAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYL
YENTQCWERNEVKAIWWIIRTPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLL
GVHEVVFAPVTEEQARGALRFAKLGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQ
RQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000164
ORF Size 1398 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000164.2, NP_000155
RefSeq Size 2024
RefSeq ORF 1401
Locus ID 2696
Cytogenetics 19q13.32
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
Gene Summary This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.