CDC7 (NM_003503) Human Tagged ORF Clone

CAT#: RG210742

CDC7 (GFP-tagged) - Human cell division cycle 7 homolog (S. cerevisiae) (CDC7), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CDC7 (NM_003503) Human Tagged ORF Clone
Symbol CDC7
Synonyms CDC7L1; HsCDC7; Hsk1; huCDC7
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG210742 representing NM_003503
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGTCTTTGGGGATTCAGATGGATGAGCCAATGGCTTTTTCTCCCCAGCGTGACCGGTTTCAGG
CTGAAGGCTCTTTAAAAAAAAACGAGCAGAATTTTAAACTTGCAGGTGTTAAAAAAGATATTGAGAAGCT
TTATGAAGCTGTACCACAGCTTAGTAATGTGTTTAAGATTGAGGACAAAATTGGAGAAGGCACTTTCAGC
TCTGTTTATTTGGCCACAGCACAGTTACAAGTAGGACCTGAAGAGAAAATTGCTCTAAAACACTTGATTC
CAACAAGTCATCCTATAAGAATTGCAGCTGAACTTCAGTGCCTAACAGTGGCTGGGGGGCAAGATAATGT
CATGGGAGTTAAATACTGCTTTAGGAAGAATGATCATGTAGTTATTGCTATGCCATATCTGGAGCATGAG
TCGTTTTTGGACATTCTGAATTCTCTTTCCTTTCAAGAAGTACGGGAATATATGCTTAATCTGTTCAAAG
CTTTGAAACGCATTCATCAGTTTGGTATTGTTCACCGTGATGTTAAGCCCAGCAATTTTTTATATAATAG
GCGCCTGAAAAAGTATGCCTTGGTAGACTTTGGTTTGGCCCAAGGAACCCATGATACGAAAATAGAGCTT
CTTAAATTTGTCCAGTCTGAAGCTCAGCAGGAAAGGTGTTCACAAAACAAATCCCACATAATCACAGGAA
ACAAGATTCCACTGAGTGGCCCAGTACCTAAGGAGCTGGATCAGCAGTCCACCACAAAAGCTTCTGTTAA
AAGACCCTACACAAATGCACAAATTCAGATTAAACAAGGAAAAGACGGAAAGGAGGGATCTGTAGGCCTT
TCTGTCCAGCGCTCTGTTTTTGGAGAAAGAAATTTCAATATACACAGCTCCATTTCACATGAGAGCCCTG
CAGTGAAACTCATGAAGCAGTCAAAGACTGTGGATGTACTGTCTAGAAAGTTAGCAACAAAAAAGAAGGC
TATTTCTACAAAAGTTATGAATAGTGCTGTGATGAGGAAAACTGCCAGTTCTTGCCCAGCTAGCCTGACC
TGTGACTGCTATGCAACAGATAAAGTTTGTAGTATTTGCCTTTCAAGGCGTCAGCAGGTTGCCCCTAGGG
CAGGTACACCAGGATTCAGAGCACCAGAGGTCTTGACAAAGTGCCCCAATCAAACTACAGCAATTGACAT
GTGGTCTGCAGGTGTCATATTTCTTTCTTTGCTTAGTGGACGATATCCATTTTATAAAGCAAGTGATGAT
TTAACTGCTTTGGCCCAAATTATGACAATTAGGGGATCCAGAGAAACTATCCAAGCTGCTAAAACTTTTG
GGAAATCAATATTATGTAGCAAAGAAGTTCCAGCACAAGACTTGAGAAAACTCTGTGAGAGACTCAGGGG
TATGGATTCTAGCACTCCCAAGTTAACAAGTGATATACAAGGGCATGCTTCTCATCAACCAGCTATTTCA
GAGAAGACTGACCATAAAGCTTCTTGCCTCGTTCAAACACCTCCAGGACAATACTCAGGGAATTCATTTA
AAAAGGGGGATAGTAATAGCTGTGAGCATTGTTTTGATGAGTATAATACCAATTTAGAAGGCTGGAATGA
GGTACCTGATGAAGCTTATGACCTGCTTGATAAACTTCTAGATCTAAATCCAGCTTCAAGAATAACAGCA
GAAGAAGCTTTGTTGCATCCATTTTTTAAAGATATGAGCTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210742 representing NM_003503
Red=Cloning site Green=Tags(s)

MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKIEDKIGEGTFS
SVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHE
SFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIEL
LKFVQSEAQQERCSQNKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGL
SVQRSVFGERNFNIHSSISHESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLT
CDCYATDKVCSICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQGHASHQPAIS
EKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPDEAYDLLDKLLDLNPASRITA
EEALLHPFFKDMSL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_003503
ORF Size 1722 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003503.2, NP_003494
RefSeq Size 3178
RefSeq ORF 1725
Locus ID 8317
Cytogenetics 1p22.1
Domains pkinase, TyrKc, S_TKc
Protein Families Protein Kinase, Stem cell - Pluripotency, Druggable Genome
Protein Pathways Cell cycle
Gene Summary This gene encodes a cell division cycle protein with kinase activity that is critical for the G1/S transition. The yeast homolog is also essential for initiation of DNA replication as cell division occurs. Overexpression of this gene product may be associated with neoplastic transformation for some tumors. Multiple alternatively spliced transcript variants that encode the same protein have been detected. [provided by RefSeq, Aug 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations