ACCN1(ASIC2) (NM_001094) Human Tagged ORF Clone

CAT#: RG210409

  • TrueORF®

ASIC2 (GFP-tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2

  View "NM_001094" in other vectors (10)

USD 650.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ACCN1(ASIC2) (NM_001094) Human Tagged ORF Clone
Symbol ASIC2
Synonyms ACCN; ACCN1; ASIC2a; BNaC1; BNC1; hBNaC1; MDEG
Vector pCMV6-AC-GFP
Sequence Data
>RG210409 representing NM_001094
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTCAAGGAAAGCCCCAGTGAGGGCAGCCTGCAACCTTCTAGCATCCAGATCTTTGCCAACACCT
CCACCCTCCATGGCATCCGCCACATCTTCGTGTATGGGCCGCTGACCATCCGGCGTGTGCTGTGGGCAGT
GGCCTTCGTGGGCTCTCTGGGCCTGCTGCTGGTGGAGAGCTCTGAGAGGGTGTCCTACTACTTCTCCTAC
CAGCATGTCACTAAGGTGGACGAAGTGGTGGCTCAAAGCCTGGTCTTCCCAGCTGTGACCCTCTGTAACC
TCAATGGCTTCCGGTTCTCCAGGCTCACCACCAACGACCTGTACCATGCTGGGGAGCTGCTGGCCCTGCT
GGATGTCAACCTGCAGATCCCGGACCCCCATCTGGCTGACCCCTCCGTGCTGGAGGCCCTGCGGCAGAAG
GCCAACTTCAAGCACTACAAACCCAAGCAGTTCAGCATGCTGGAGTTCCTGCACCGTGTGGGCCATGACC
TGAAGGATATGATGCTCTACTGCAAGTTCAAAGGGCAGGAGTGCGGCCACCAAGACTTCACCACAGTGTT
TACAAAATATGGGAAGTGTTACATGTTTAACTCAGGCGAGGATGGCAAACCTCTGCTCACCACGGTCAAG
GGGGGGACAGGCAACGGGCTGGAGATCATGCTGGACATTCAGCAGGATGAGTACCTGCCCATCTGGGGAG
AGACAGAGGAAACGACATTTGAAGCAGGAGTGAAAGTTCAGATCCACAGTCAGTCTGAGCCACCTTTCAT
CCAAGAGCTGGGCTTTGGGGTGGCTCCAGGGTTCCAGACCTTTGTGGCCACACAGGAGCAGAGGCTCACA
TACCTGCCCCCACCGTGGGGTGAGTGCCGATCCTCAGAGATGGGCCTCGACTTTTTTCCTGTTTACAGCA
TCACCGCCTGTAGGATTGACTGTGAGACCCGCTACATTGTGGAAAACTGCAACTGCCGCATGGTTCACAT
GCCAGGGGATGCCCCTTTTTGTACCCCTGAGCAGCACAAGGAGTGTGCAGAGCCTGCCCTAGGTCTGTTG
GCGGAAAAGGACAGCAATTACTGTCTCTGCAGGACACCCTGCAACCTAACCCGCTACAACAAAGAGCTCT
CCATGGTGAAGATCCCCAGCAAGACATCAGCCAAGTACCTTGAGAAGAAATTTAACAAATCAGAAAAATA
TATCTCAGAGAACATCCTTGTTCTGGATATATTTTTTGAAGCTCTCAATTATGAGACAATTGAACAGAAG
AAGGCGTATGAAGTTGCTGCCTTACTTGGTGATATTGGTGGTCAGATGGGATTGTTCATTGGTGCTAGTA
TCCTTACAATACTAGAGCTCTTTGATTATATTTATGAGCTGATCAAAGAGAAGCTATTAGACCTGCTTGG
CAAAGAGGAGGACGAAGGGAGCCACGATGAGAATGTGAGTACTTGTGACACAATGCCAAACCACTCTGAA
ACCATCAGTCACACTGTGAACGTGCCCCTGCAGACGACCCTGGGGACCTTGGAGGAGATTGCCTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG210409 representing NM_001094
Red=Cloning site Green=Tags(s)

MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVESSERVSYYFSY
QHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVNLQIPDPHLADPSVLEALRQK
ANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKYGKCYMFNSGEDGKPLLTTVK
GGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLT
YLPPPWGECRSSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLL
AEKDSNYCLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK
KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHSE
TISHTVNVPLQTTLGTLEEIAC

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001094
ORF Size 1536 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001094.4, NP_001085
RefSeq Size 2747
RefSeq ORF 1539
Locus ID 40
Cytogenetics 17q11.2-q12
Protein Families Ion Channels: Other, Druggable Genome
Protein Pathways Taste transduction
Gene Summary Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate. [UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "ASIC2"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies