ATOH1 (NM_005172) Human Tagged ORF Clone

CAT#: RG210192

Reviews ()
Write a review
  • TrueORF®

ATOH1 (GFP-tagged) - Human atonal homolog 1 (Drosophila) (ATOH1)



  "NM_005172" in other vectors (6)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ATOH1 (NM_005172) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ATOH1
Synonyms ATH1; bHLHa14; HATH1; MATH-1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG210192 representing NM_005172
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCGCCTGCTGCATGCAGAAGAGTGGGCTGAAGTGAAGGAGTTGGGAGACCACCATCGCCAGCCCC
AGCCGCATCATCTCCCGCAACCGCCGCCGCCGCCGCAGCCACCTGCAACTTTGCAGGCGAGAGAGCATCC
CGTCTACCCGCCTGAGCTGTCCCTCCTGGACAGCACCGACCCACGCGCCTGGCTGGCTCCCACTTTGCAG
GGCATCTGCACGGCACGCGCCGCCCAGTATTTGCTACATTCCCCGGAGCTGGGTGCCTCAGAGGCCGCTG
CGCCCCGGGACGAGGTGGACGGCCGGGGGGAGCTGGTAAGGAGGAGCAGCGGCGGTGCCAGCAGCAGCAA
GAGCCCCGGGCCGGTGAAAGTGCGGGAACAGCTGTGCAAGCTGAAAGGCGGGGTGGTGGTAGACGAGCTG
GGCTGCAGCCGCCAACGGGCCCCTTCCAGCAAACAGGTGAATGGGGTGCAGAAGCAGAGACGGCTAGCAG
CCAACGCCAGGGAGCGGCGCAGGATGCATGGGCTGAACCACGCCTTCGACCAGCTGCGCAATGTTATCCC
GTCGTTCAACAACGACAAGAAGCTGTCCAAATATGAGACCCTGCAGATGGCCCAAATCTACATCAACGCC
TTGTCCGAGCTGCTACAAACGCCCAGCGGAGGGGAACAGCCACCGCCGCCTCCAGCCTCCTGCAAAAGCG
ACCACCACCACCTTCGCACCGCGGCCTCCTATGAAGGGGGCGCGGGCAACGCGACCGCAGCTGGGGCTCA
GCAGGCTTCCGGAGGGAGCCAGCGGCCGACCCCGCCCGGGAGTTGCCGGACTCGCTTCTCAGCCCCAGCT
TCTGCGGGAGGGTACTCGGTGCAGCTGGACGCTCTGCACTTCTCGACTTTCGAGGACAGCGCCCTGACAG
CGATGATGGCGCAAAAGAATTTGTCTCCTTCTCTCCCCGGGAGCATCTTGCAGCCAGTGCAGGAGGAAAA
CAGCAAAACTTCGCCTCGGTCCCACAGAAGCGACGGGGAATTTTCCCCCCATTCCCATTACAGTGACTCG
GATGAGGCAAGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG210192 representing NM_005172
Red=Cloning site Green=Tags(s)

MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQ
GICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDEL
GCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINA
LSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPA
SAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDS
DEAS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005172
ORF Size 1062 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005172.1, NP_005163.1
RefSeq Size 1065 bp
RefSeq ORF 1065 bp
Locus ID 474
Cytogenetics 4q22.2
Protein Families Druggable Genome, Transcription Factors
Gene Summary This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "ATOH1"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit Polyclonal Antibody against ATOH1 (N-term)
    • 100 ug

USD 450.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools