GPR15 (NM_005290) Human Tagged ORF Clone

CAT#: RG210145

GPR15 (GFP-tagged) - Human G protein-coupled receptor 15 (GPR15)

Change vector?

  • TrueORF®

USD 495


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPR15 (NM_005290) Human Tagged ORF Clone
Symbol GPR15
Synonyms BOB
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG210145 representing NM_005290
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCAGAAGAAACTTCAGTTTATTTGGATTATTACTATGCTACGAGCCCAAACTCTGACATCAGGG
AGACCCACTCCCATGTTCCTTACACCTCTGTCTTCCTTCCAGTCTTTTACACAGCTGTGTTCCTGACTGG
AGTGCTGGGGAACCTTGTTCTCATGGGAGCGTTGCATTTCAAACCCGGCAGCCGAAGACTGATCGACATC
TTTATCATCAATCTGGCTGCCTCTGACTTCATTTTTCTTGTCACATTGCCTCTCTGGGTGGATAAAGAAG
CATCTCTAGGACTGTGGAGGACGGGCTCCTTCCTGTGCAAAGGGAGCTCCTACATGATCTCCGTCAATAT
GCACTGCAGTGTCCTCCTGCTCACTTGCATGAGTGTTGACCGCTACCTGGCCATTGTGTGGCCAGTCGTA
TCCAGGAAATTCAGAAGGACAGACTGTGCATATGTAGTCTGTGCCAGCATCTGGTTTATCTCCTGCCTGC
TGGGGTTGCCTACTCTTCTGTCCAGGGAGCTCACGCTGATTGATGATAAGCCATACTGTGCAGAGAAAAA
GGCAACTCCAATTAAACTCATATGGTCCCTGGTGGCCTTAATTTTCACCTTTTTTGTCCCTTTGTTGAGC
ATTGTGACCTGCTACTGTTGCATTGCAAGGAAGCTGTGTGCCCATTACCAGCAATCAGGAAAGCACAACA
AAAAGCTGAAGAAATCTATAAAGATCATCTTTATTGTCGTGGCAGCCTTTCTTGTCTCCTGGCTGCCCTT
CAATACTTTCAAGTTCCTGGCCATTGTCTCTGGGTTGCGGCAAGAACACTATTTACCCTCAGCTATTCTT
CAGCTTGGTATGGAGGTGAGTGGACCCTTGGCATTTGCCAACAGCTGTGTCAACCCTTTCATTTACTATA
TCTTCGACAGCTACATCCGCCGGGCCATTGTCCACTGCTTGTGCCCTTGCCTGAAAAACTATGACTTTGG
GAGTAGCACTGAGACATCAGATAGTCACCTCACTAAGGCTCTCTCCACCTTCATTCATGCAGAAGATTTT
GCCAGGAGGAGGAAGAGGTCTGTGTCACTCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210145 representing NM_005290
Red=Cloning site Green=Tags(s)

MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDI
FIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVV
SRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLS
IVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAIL
QLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDF
ARRRKRSVSL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005290
ORF Size 1081 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005290.1, NP_005281
RefSeq Size 1083
RefSeq ORF 1083
Locus ID 2838
Cytogenetics 3q11.2
Protein Families GPCR, Transmembrane, Druggable Genome
Gene Summary Probable chemokine receptor. Alternative coreceptor with CD4 for HIV-1 infection. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations