IFNA21 (NM_002175) Human Tagged ORF Clone

SKU
RG210115
IFNA21 (tGFP-tagged) - Human interferon, alpha 21 (IFNA21)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IFNA21
Synonyms IFN-alphaI; leIF-F; LeIF F
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210115 representing NM_002175
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTGTCCTTTTCTTTACTGATGGCCGTGCTGGTGCTCAGCTACAAATCCATCTGTTCTCTGGGCT
GTGATCTGCCTCAGACCCACAGCCTGGGTAATAGGAGGGCCTTGATACTCCTGGCACAAATGGGAAGAAT
CTCTCCTTTCTCCTGCCTGAAGGACAGACATGACTTTGGATTCCCCCAGGAGGAGTTTGATGGCAACCAG
TTCCAGAAGGCTCAAGCCATCTCTGTCCTCCATGAGATGATCCAGCAGACCTTCAATCTCTTCAGCACAA
AGGACTCATCTGCTACTTGGGAACAGAGCCTCCTAGAAAAATTTTCCACTGAACTTAACCAGCAGCTGAA
TGACCTGGAAGCCTGCGTGATACAGGAGGTTGGGGTGGAAGAGACTCCCCTGATGAATGTGGACTCCATC
CTGGCTGTGAAGAAATACTTCCAAAGAATCACTCTTTATCTGACAGAGAAGAAATACAGCCCTTGTGCCT
GGGAGGTTGTCAGAGCAGAAATCATGAGATCCTTCTCTTTATCAAAAATTTTTCAAGAAAGATTAAGGAG
GAAGGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210115 representing NM_002175
Red=Cloning site Green=Tags(s)

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQ
FQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSI
LAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002175
ORF Size 567 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002175.2, NP_002166.2
RefSeq Size 985 bp
RefSeq ORF 570 bp
Locus ID 3452
UniProt ID P01568
Cytogenetics 9p21.3
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Summary This gene is a member of the alpha interferon gene cluster on the short arm of chromosome 9. Interferons are cytokines produced in response to viral infection that mediate the immune response and interfere with viral replication. The encoded protein is a type I interferon and may play a specific role in the antiviral response to rubella virus. [provided by RefSeq, Sep 2011]
Write Your Own Review
You're reviewing:IFNA21 (NM_002175) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210115 IFNA21 (Myc-DDK-tagged)-Human interferon, alpha 21 (IFNA21) 10 ug
$300.00
RC210115L1 Lenti ORF clone of Human interferon, alpha 21 (IFNA21), Myc-DDK-tagged 10 ug
$600.00
RC210115L2 Lenti ORF clone of Human interferon, alpha 21 (IFNA21), mGFP tagged 10 ug
$600.00
RC210115L3 Lenti ORF clone of Human interferon, alpha 21 (IFNA21), Myc-DDK-tagged 10 ug
$600.00
RC210115L4 Lenti ORF clone of Human interferon, alpha 21 (IFNA21), mGFP tagged 10 ug
$600.00
SC303137 IFNA21 (untagged)-Human interferon, alpha 21 (IFNA21) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.