WNT2 (NM_003391) Human Tagged ORF Clone

CAT#: RG210089

Reviews ()
Write a review
  • TrueORF®

WNT2 (GFP-tagged) - Human wingless-type MMTV integration site family member 2 (WNT2), transcript variant 1



  "NM_003391" in other vectors (6)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name WNT2 (NM_003391) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol WNT2
Synonyms INT1L1; IRP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG210089 representing NM_003391
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGCCCCTCTCGGTGGAATCTGGCTCTGGCTCCCTCTGCTCTTGACCTGGCTCACCCCCGAGGTCA
ACTCTTCATGGTGGTACATGAGAGCTACAGGTGGCTCCTCCAGGGTGATGTGCGATAATGTGCCAGGCCT
GGTGAGCAGCCAGCGGCAGCTGTGTCACCGACATCCAGATGTGATGCGTGCCATTAGCCAGGGCGTGGCC
GAGTGGACAGCAGAATGCCAGCACCAGTTCCGCCAGCACCGCTGGAATTGCAACACCCTGGACAGGGATC
ACAGCCTTTTTGGCAGGGTCCTACTCCGAAGTAGTCGGGAATCTGCCTTTGTTTATGCCATCTCCTCAGC
TGGAGTTGTATTTGCCATCACCAGGGCCTGTAGCCAAGGAGAAGTAAAATCCTGTTCCTGTGATCCAAAG
AAGATGGGAAGCGCCAAGGACAGCAAAGGCATTTTTGATTGGGGTGGCTGCAGTGATAACATTGACTATG
GGATCAAATTTGCCCGCGCATTTGTGGATGCAAAGGAAAGGAAAGGAAAGGATGCCAGAGCCCTGATGAA
TCTTCACAACAACAGAGCTGGCAGGAAGGCTGTAAAGCGGTTCTTGAAACAAGAGTGCAAGTGCCACGGG
GTGAGCGGCTCATGTACTCTCAGGACATGCTGGCTGGCCATGGCCGACTTCAGGAAAACGGGCGATTATC
TCTGGAGGAAGTACAATGGGGCCATCCAGGTGGTCATGAACCAGGATGGCACAGGTTTCACTGTGGCTAA
CGAGAGGTTTAAGAAGCCAACGAAAAATGACCTCGTGTATTTTGAGAATTCTCCAGACTACTGTATCAGG
GACCGAGAGGCAGGCTCCCTGGGTACAGCAGGCCGTGTGTGCAACCTGACTTCCCGGGGCATGGACAGCT
GTGAAGTCATGTGCTGTGGGAGAGGCTACGACACCTCCCATGTCACCCGGATGACCAAGTGTGGGTGTAA
GTTCCACTGGTGCTGCGCCGTGCGCTGTCAGGACTGCCTGGAAGCTCTGGATGTGCACACATGCAAGGCC
CCCAAGAACGCTGACTGGACAACCGCTACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG210089 representing NM_003391
Red=Cloning site Green=Tags(s)

MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVA
EWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPK
KMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHG
VSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIR
DREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKA
PKNADWTTAT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_003391
ORF Size 1080 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003391.1, NP_003382.1
RefSeq Size 2301 bp
RefSeq ORF 1083 bp
Locus ID 7472
Cytogenetics 7q31.2
Domains wnt
Protein Families Adult stem cells, Cancer stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway
Protein Pathways Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway
Gene Summary This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "WNT2"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit Polyclonal Anti-WNT2 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools