FAM111A (NM_022074) Human Tagged ORF Clone

CAT#: RG210012

FAM111A (GFP-tagged) - Human family with sequence similarity 111, member A (FAM111A), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FAM111A (NM_022074) Human Tagged ORF Clone
Symbol FAM111A
Synonyms GCLEB; KCS2
Vector pCMV6-AC-GFP
Sequence Data
>RG210012 representing NM_022074
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTGTAAGAAGCAGAGGTCACGGAAGCACTCAGTCAATGAAAAATGTAATATGAAAATCGAGCACT
ATTTTTCTCCGGTCTCTAAAGAGCAACAGAATAATTGCAGTACTTCTCTAATGAGGATGGAGTCTAGAGG
AGACCCAAGAGCCACAACTAATACCCAGGCTCAAAGATTCCATTCACCTAAGAAAAATCCAGAAGACCAG
ACCATGCCCCAAAATAGGACAATATATGTTACCTTGAAGGTAAACCACAGGAGAAACCAAGATATGAAAC
TTAAGCTCTCACATAGTGAGAATAGTAGCTTATATATGGCTCTCAACACTCTCCAGGCTGTCAGAAAAGA
GATAGAAACTCACCAAGGCCAAGAAATGCTTGTGCGTGGCACAGAAGGAATCAAAGAGTACATAAACCTT
GGAATGCCCCTCAGTTGTTTCCCTGAAGGTGGCCAGGTGGTCATTACATTTTCCCAAAGTAAAAGTAAGC
AGAAGGAAGATAACCACATATTTGGCAGGCAGGACAAAGCATCGACTGAATGTGTCAAATTTTACATTCA
TGCAATTGGAATTGGGAAGTGTAAAAGAAGGATTGTTAAATGTGGGAAGCTTCACAAAAAGGGGCGCAAA
CTCTGTGTTTATGCTTTCAAAGGAGAAACCATCAAGGATGCACTGTGCAAGGATGGCAGATTTCTTTCCT
TTCTGGAGAATGATGATTGGAAACTCATTGAAAACAATGACACCATTTTAGAAAGCACCCAGCCAGTTGA
TGAATTAGAAGGCAGATACTTTCAGGTTGAGGTTGAGAAAAGAATGGTCCCCAGTGCAGCAGCTTCTCAG
AATCCTGAGTCAGAGAAAAGAAACACCTGTGTGTTGAGAGAACAAATCGTGGCTCAGTACCCCAGTTTGA
AAAGAGAAAGTGAAAAAATCATTGAAAACTTCAAGAAAAAAATGAAAGTAAAAAATGGGGAAACATTATT
TGAATTGCATAGAACAACGTTTGGGAAAGTAACAAAAAATTCTTCTTCGATTAAAGTAGTGAAACTTCTT
GTACGTCTCAGTGACTCAGTTGGGTACTTATTCTGGGACAGTGCAACTACGGGTTACGCCACCTGCTTTG
TTTTTAAAGGATTGTTCATTTTAACTTGTCGGCATGTAATAGATAGCATTGTGGGAGACGGAATAGAGCC
AAGTAAGTGGGCAACCATAATTGGTCAATGTGTAAGGGTGACATTTGGTTATGAAGAGCTAAAAGACAAG
GAAACAAACTACTTTTTTGTTGAACCTTGGTTTGAGATACATAATGAAGAGCTTGACTATGCTGTCCTGA
AACTGAAGGAAAATGGACAACAAGTACCTATGGAACTATATAATGGAATTACTCCTGTGCCACTTAGTGG
GTTGATACATATTATTGGCCATCCATATGGAGAAAAAAAGCAGATTGATGCTTGTGCTGTGATCCCTCAG
GGTCAGCGAGCAAAGAAATGTCAGGAACGTGTTCAGTCTAAAAAAGCAGAAAGTCCAGAGTATGTCCATA
TGTATACTCAAAGAAGTTTCCAGAAAATAGTTCACAACCCTGATGTGATTACCTATGACACTGAATTTTT
CTTTGGGGCTTCCGGCTCCCCTGTGTTTGATTCAAAAGGTTCATTGGTGGCCATGCATGCTGCTGGCTTT
GCTTATACTTACCAAAATGAGACTCGTAGTATCATTGAGTTTGGCTCTACCATGGAATCCATCCTCCTTG
ATATTAAGCAAAGACATAAACCATGGTATGAAGAAGTATTTGTAAATCAGCAGGATGTAGAAATGATGAG
TGATGAGGACTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG210012 representing NM_022074
Red=Cloning site Green=Tags(s)

MSCKKQRSRKHSVNEKCNMKIEHYFSPVSKEQQNNCSTSLMRMESRGDPRATTNTQAQRFHSPKKNPEDQ
TMPQNRTIYVTLKVNHRRNQDMKLKLSHSENSSLYMALNTLQAVRKEIETHQGQEMLVRGTEGIKEYINL
GMPLSCFPEGGQVVITFSQSKSKQKEDNHIFGRQDKASTECVKFYIHAIGIGKCKRRIVKCGKLHKKGRK
LCVYAFKGETIKDALCKDGRFLSFLENDDWKLIENNDTILESTQPVDELEGRYFQVEVEKRMVPSAAASQ
NPESEKRNTCVLREQIVAQYPSLKRESEKIIENFKKKMKVKNGETLFELHRTTFGKVTKNSSSIKVVKLL
VRLSDSVGYLFWDSATTGYATCFVFKGLFILTCRHVIDSIVGDGIEPSKWATIIGQCVRVTFGYEELKDK
ETNYFFVEPWFEIHNEELDYAVLKLKENGQQVPMELYNGITPVPLSGLIHIIGHPYGEKKQIDACAVIPQ
GQRAKKCQERVQSKKAESPEYVHMYTQRSFQKIVHNPDVITYDTEFFFGASGSPVFDSKGSLVAMHAAGF
AYTYQNETRSIIEFGSTMESILLDIKQRHKPWYEEVFVNQQDVEMMSDEDL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_022074
ORF Size 1833 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_022074.2, NP_071357
RefSeq Size 3662
RefSeq ORF 1836
Locus ID 63901
Cytogenetics 11q12.1
Gene Summary The protein encoded by this gene is cell-cycle regulated, and has nuclear localization. The C-terminal half of the protein shares homology with trypsin-like peptidases and it contains a PCNA-interacting peptide (PIP) box, that is necessary for its co-localization with proliferating cell nuclear antigen (PCNA). Reduced expression of this gene resulted in DNA replication defects, consistent with the demonstrated role for this gene in Simian Virus 40 (SV40) viral replication. Mutations in this gene have been associated with Kenny-Caffey syndrome (KCS) type 2 and the more severe osteocraniostenosis (OCS, also known as Gracile Bone Dysplasia), both characterized by short stature, hypoparathyroidism, bone development abnormalities, and hypocalcemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)