HDAC6 (NM_006044) Human Tagged ORF Clone

CAT#: RG209649

HDAC6 (GFP-tagged) - Human histone deacetylase 6 (HDAC6)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 917.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HDAC6 (NM_006044) Human Tagged ORF Clone
Symbol HDAC6
Synonyms CPBHM; HD6; JM21; PPP1R90
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG209649 representing NM_006044
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCTCAACCGGCCAGGATTCCACCACAACCAGGCAGCGAAGAAGTAGGCAGAACCCCCAGTCGCCCC
CTCAGGACTCCAGTGTCACTTCGAAGCGAAATATTAAAAAGGGAGCCGTTCCCCGCTCTATCCCCAATCT
AGCGGAGGTAAAGAAGAAAGGCAAAATGAAGAAGCTCGGCCAAGCAATGGAAGAAGACCTAATCGTGGGA
CTGCAAGGGATGGATCTGAACCTTGAGGCTGAAGCACTGGCTGGCACTGGCTTGGTGTTGGATGAGCAGT
TAAATGAATTCCATTGCCTCTGGGATGACAGCTTCCCGGAAGGCCCTGAGCGGCTCCATGCCATCAAGGA
GCAACTGATCCAGGAGGGCCTCCTAGATCGCTGCGTGTCCTTTCAGGCCCGGTTTGCTGAAAAGGAAGAG
CTGATGTTGGTTCACAGCCTAGAATATATTGATCTGATGGAAACAACCCAGTACATGAATGAGGGAGAAC
TCCGTGTCCTAGCAGACACCTACGACTCAGTTTATCTGCATCCGAACTCATACTCCTGTGCCTGCCTGGC
CTCAGGCTCTGTCCTCAGGCTGGTGGATGCGGTCCTGGGGGCTGAGATCCGGAATGGCATGGCCATCATT
AGGCCTCCTGGACATCACGCCCAGCACAGTCTTATGGATGGCTATTGCATGTTCAACCACGTGGCTGTGG
CAGCCCGCTATGCTCAACAGAAACACCGCATCCGGAGGGTCCTTATCGTAGATTGGGATGTGCACCACGG
TCAAGGAACACAGTTCACCTTCGACCAGGACCCCAGTGTCCTCTATTTCTCCATCCACCGCTACGAGCAG
GGTAGGTTCTGGCCCCACCTGAAGGCCTCTAACTGGTCCACCACAGGTTTCGGCCAAGGCCAAGGATATA
CCATCAATGTGCCTTGGAACCAGGTGGGGATGCGGGATGCTGACTACATTGCTGCTTTCCTGCACGTCCT
GCTGCCAGTCGCCCTCGAGTTCCAGCCTCAGCTGGTCCTGGTGGCTGCTGGATTTGATGCCCTGCAAGGG
GACCCCAAGGGTGAGATGGCCGCCACTCCGGCAGGGTTCGCCCAGCTAACCCACCTGCTCATGGGTCTGG
CAGGAGGCAAGCTGATCCTGTCTCTGGAGGGTGGCTACAACCTCCGCGCCCTGGCTGAAGGCGTCAGTGC
TTCGCTCCACACCCTTCTGGGAGACCCTTGCCCCATGCTGGAGTCACCTGGTGCCCCCTGCCGGAGTGCC
CAGGCTTCAGTTTCCTGTGCTCTGGAAGCCCTTGAGCCCTTCTGGGAGGTTCTTGTGAGATCAACTGAGA
CCGTGGAGAGGGACAACATGGAGGAGGACAATGTAGAGGAGAGCGAGGAGGAAGGACCCTGGGAGCCCCC
TGTGCTCCCAATCCTGACATGGCCAGTGCTACAGTCTCGCACAGGGCTGGTCTATGACCAAAATATGATG
AATCACTGCAACTTGTGGGACAGCCACCACCCTGAGGTACCCCAGCGCATCTTGCGGATCATGTGCCGTC
TGGAGGAGCTGGGCCTTGCCGGGCGCTGCCTCACCCTGACACCGCGCCCTGCCACAGAGGCTGAGCTGCT
CACCTGTCACAGTGCTGAGTACGTGGGTCATCTCCGGGCCACAGAGAAAATGAAAACCCGGGAGCTGCAC
CGTGAGAGTTCCAACTTTGACTCCATCTATATCTGCCCCAGTACCTTCGCCTGTGCACAGCTTGCCACTG
GCGCTGCCTGCCGCCTGGTGGAGGCTGTGCTCTCAGGAGAGGTTCTGAATGGTGCTGCTGTGGTGCGTCC
CCCAGGACACCACGCAGAGCAGGATGCAGCTTGCGGTTTTTGCTTTTTCAACTCTGTGGCTGTGGCTGCT
CGCCATGCCCAGACTATCAGTGGGCATGCCCTACGGATCCTGATTGTGGATTGGGATGTCCACCACGGTA
ATGGAACTCAGCACATGTTTGAGGATGACCCCAGTGTGCTATATGTGTCCCTGCACCGCTATGATCATGG
CACCTTCTTCCCCATGGGGGATGAGGGTGCCAGCAGCCAGATCGGCCGGGCTGCGGGCACAGGCTTCACC
GTCAACGTGGCATGGAACGGGCCCCGCATGGGTGATGCTGACTACCTAGCTGCCTGGCATCGCCTGGTGC
TTCCCATTGCCTACGAGTTTAACCCAGAACTGGTGCTGGTCTCAGCTGGCTTTGATGCTGCACGGGGGGA
TCCGCTGGGGGGCTGCCAGGTGTCACCTGAGGGTTATGCCCACCTCACCCACCTGCTGATGGGCCTTGCC
AGTGGCCGCATTATCCTTATCCTAGAGGGTGGCTATAACCTGACATCCATCTCAGAGTCCATGGCTGCCT
GCACTCGCTCCCTCCTTGGAGACCCACCACCCCTGCTGACCCTGCCACGGCCCCCACTATCAGGGGCCCT
GGCCTCAATCACTGAGACCATCCAAGTCCATCGCAGATACTGGCGCAGCTTACGGGTCATGAAGGTAGAA
GACAGAGAAGGACCCTCCAGTTCTAAGTTGGTCACCAAGAAGGCACCCCAACCAGCCAAACCTAGGTTAG
CTGAGCGGATGACCACACGAGAAAAGAAGGTTCTGGAAGCAGGCATGGGGAAAGTCACCTCGGCATCATT
TGGGGAAGAGTCCACTCCAGGCCAGACTAACTCAGAGACAGCTGTGGTGGCCCTCACTCAGGACCAGCCC
TCAGAGGCAGCCACAGGGGGAGCCACTCTGGCCCAGACCATTTCTGAGGCAGCCATTGGGGGAGCCATGC
TGGGCCAGACCACCTCAGAGGAGGCTGTCGGGGGAGCCACTCCGGACCAGACCACCTCAGAGGAGACTGT
GGGAGGAGCCATTCTGGACCAGACCACCTCAGAGGATGCTGTTGGGGGAGCCACGCTGGGCCAGACTACC
TCAGAGGAGGCTGTAGGAGGAGCTACACTGGCCCAGACCACCTCGGAGGCAGCCATGGAGGGAGCCACAC
TGGACCAGACTACGTCAGAGGAGGCTCCAGGGGGCACCGAGCTGATCCAAACTCCTCTAGCCTCGAGCAC
AGACCACCAGACCCCCCCAACCTCACCTGTGCAGGGAACTACACCCCAGATATCTCCCAGTACACTGATT
GGGAGTCTCAGGACCTTGGAGCTAGGCAGCGAATCTCAGGGGGCCTCAGAATCTCAGGCCCCAGGAGAGG
AGAACCTACTAGGAGAGGCAGCTGGAGGTCAGGACATGGCTGATTCGATGCTGATGCAGGGATCTAGGGG
CCTCACTGATCAGGCCATATTTTATGCTGTGACACCACTGCCCTGGTGTCCCCATTTGGTGGCAGTATGC
CCCATACCTGCAGCAGGCCTAGACGTGACCCAACCTTGTGGGGACTGTGGAACAATCCAAGAGAATTGGG
TGTGTCTCTCTTGCTATCAGGTCTACTGTGGTCGTTACATCAATGGCCACATGCTCCAACACCATGGAAA
TTCTGGACACCCGCTGGTCCTCAGCTACATCGACCTGTCAGCCTGGTGTTACTACTGTCAGGCCTATGTC
CACCACCAGGCTCTCCTAGATGTGAAGAACATCGCCCACCAGAACAAGTTTGGGGAGGATATGCCCCACC
CACAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209649 representing NM_006044
Red=Cloning site Green=Tags(s)

MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVG
LQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEE
LMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAII
RPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQ
GRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQG
DPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMM
NHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRELH
RESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAA
RHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFT
VNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLA
SGRIILILEGGYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQP
SEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTT
SEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLI
GSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVC
PIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYV
HHQALLDVKNIAHQNKFGEDMPHPH

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_006044
ORF Size 3645 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006044.2, NP_006035
RefSeq Size 4099
RefSeq ORF 3648
Locus ID 10013
Cytogenetics Xp11.23
Domains Hist_deacetyl, zf-UBP
Protein Families Transcription Factors, Druggable Genome
Gene Summary Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)