DDX47 (NM_016355) Human Tagged ORF Clone

CAT#: RG209448

DDX47 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 (DDX47), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DDX47 (NM_016355) Human Tagged ORF Clone
Symbol DDX47
Synonyms E4-DBP; HQ0256; MSTP162; RRP3
Vector pCMV6-AC-GFP
Sequence Data
>RG209448 representing NM_016355
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCACCCGAGGAACACGATTCTCCGACCGAAGCGTCCCAGCCGATTGTGGAAGAGGAGGAAACTA
AAACATTTAAAGACCTGGGTGTGACAGATGTGTTGTGTGAAGCTTGTGACCAGTTGGGATGGACAAAACC
CACCAAGATCCAGATTGAAGCTATTCCTTTGGCCTTACAAGGTCGTGATATCATTGGGCTTGCAGAAACT
GGCTCTGGAAAGACAGGCGCCTTTGCTTTGCCCATTCTAAACGCACTGCTGGAGACCCCGCAGCGTTTGT
TTGCCCTAGTTCTTACCCCGACTCGGGAGCTGGCCTTTCAGATCTCAGAGCAGTTTGAAGCCCTGGGGTC
CTCTATTGGAGTGCAGAGTGCTGTGATTGTAGGTGGAATTGATTCAATGTCTCAATCTTTGGCCCTTGCA
AAAAAACCACATATAATAATAGCAACTCCTGGTCGACTGATTGACCACTTGGAAAATACGAAAGGTTTCA
ACTTGAGAGCTCTCAAATACTTGGTCATGGATGAAGCCGACCGAATACTGAATATGGATTTTGAGACAGA
GGTTGACAAGATCCTCAAAGTGATTCCTCGAGATCGGAAAACATTCCTCTTCTCTGCCACCATGACCAAG
AAGGTTCAAAAACTTCAGCGAGCAGCTCTGAAGAATCCTGTGAAATGTGCCGTTTCCTCTAAATACCAGA
CAGTTGAAAAATTACAGCAATATTATATTTTTATTCCCTCTAAATTCAAGGATACCTACCTGGTTTATAT
TCTAAATGAATTGGCTGGAAACTCCTTTATGATATTCTGCAGCACCTGTAATAATACCCAGAGAACAGCT
TTGCTACTGCGAAATCTTGGCTTCACTGCCATCCCCCTCCATGGACAAATGAGTCAGAGTAAGCGCCTAG
GATCCCTTAATAAGTTTAAGGCCAAGGCCCGTTCCATTCTTCTAGCAACTGACGTTGCCAGCCGAGGTTT
GGACATACCTCATGTAGATGTGGTTGTCAACTTTGACATTCCTACCCATTCCAAGGATTACATCCATCGA
GTAGGTCGAACAGCTAGAGCTGGGCGCTCCGGAAAGGCTATTACTTTTGTCACACAGTATGATGTGGAAC
TCTTCCAGCGCATAGAACACTTAATTGGGAAGAAACTACCAGGTTTTCCAACACAGGATGATGAGGTTAT
GATGCTGACAGAACGCGTCGCTGAAGCCCAAAGGTTTGCCCGAATGGAGTTAAGGGAGCATGGAGAAAAG
AAGAAACGCTCGCGAGAGGATGCTGGAGATAATGATGACACAGAGGGTGCTATTGGTGTCAGGAACAAGG
TGGCTGGAGGAAAAATGAAGAAGCGGAAAGGCCGT


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG209448 representing NM_016355
Red=Cloning site Green=Tags(s)

MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAET
GSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLALA
KKPHIIIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTK
KVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYIFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTA
LLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHR
VGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEK
KKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_016355
ORF Size 1365 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016355.3, NP_057439
RefSeq Size 1836
RefSeq ORF 1368
Locus ID 51202
Cytogenetics 12p13.1
Domains DEAD, helicase_C
Gene Summary This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)