SP1 (NM_138473) Human Tagged ORF Clone

CAT#: RG209154

SP1 (GFP-tagged) - Human Sp1 transcription factor (SP1), transcript variant 1

Change vector?

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name SP1 (NM_138473) Human Tagged ORF Clone
Symbol SP1
Synonyms specificity protein 1; Sp1 transcription factor
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG209154 representing NM_138473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGACCAAGATCACTCCATGGATGAAATGACAGCTGTGGTGAAAATTGAAAAAGGAGTTGGTGGCA
ATAATGGGGGCAATGGTAATGGTGGTGGTGCCTTTTCACAGGCTCGAAGTAGCAGCACAGGCAGTAGCAG
CAGCACTGGAGGAGGAGGGCAGGAGTCCCAGCCATCCCCTTTGGCTCTGCTGGCAGCAACTTGCAGCAGA
ATTGAGTCACCCAATGAGAACAGCAACAACTCCCAGGGCCCGAGTCAGTCAGGGGGAACAGGTGAGCTTG
ACCTCACAGCCACACAACTTTCACAGGGTGCCAATGGCTGGCAGATCATCTCTTCCTCCTCTGGGGCTAC
CCCTACCTCAAAGGAACAGAGTGGCAGCAGTACCAATGGCAGCAATGGCAGTGAGTCTTCCAAGAATCGC
ACAGTCTCTGGTGGGCAGTATGTTGTGGCTGCCGCTCCCAACTTACAGAACCAGCAAGTTCTGACAGGAC
TACCTGGAGTGATGCCTAATATTCAGTATCAAGTAATCCCACAGTTCCAGACCGTTGATGGGCAACAGCT
GCAGTTTGCTGCCACTGGGGCCCAAGTGCAGCAGGATGGTTCTGGTCAAATACAGATCATACCAGGTGCA
AACCAACAGATTATCACAAATCGAGGAAGTGGAGGCAACATCATTGCTGCTATGCCAAACCTACTCCAGC
AGGCTGTCCCCCTCCAAGGCCTGGCTAATAATGTACTCTCAGGACAGACTCAGTATGTGACCAATGTACC
AGTGGCCCTGAATGGGAACATCACCTTGCTACCTGTCAACAGCGTTTCTGCAGCTACCTTGACTCCCAGC
TCTCAGGCAGTCACGATCAGCAGCTCTGGGTCCCAGGAGAGTGGCTCACAGCCTGTCACCTCAGGGACTA
CCATCAGTTCTGCCAGCTTGGTATCATCACAAGCCAGTTCCAGCTCCTTTTTCACCAATGCCAATAGCTA
CTCAACTACTACTACCACCAGCAACATGGGAATTATGAACTTTACTACCAGTGGATCATCAGGGACCAAC
TCTCAAGGCCAGACACCCCAGAGGGTCAGTGGGCTACAGGGGTCTGATGCTCTGAACATCCAGCAAAACC
AGACATCTGGAGGCTCATTGCAAGCAGGCCAGCAAAAAGAAGGAGAGCAAAACCAGCAGACACAGCAGCA
ACAAATTCTTATCCAGCCTCAGCTAGTTCAAGGGGGACAGGCCCTCCAGGCCCTCCAAGCAGCACCATTG
TCAGGGCAGACCTTTACAACTCAAGCCATCTCCCAGGAAACCCTCCAGAACCTCCAGCTTCAGGCTGTTC
CAAACTCTGGTCCCATCATCATCCGGACACCAACAGTGGGGCCCAATGGACAGGTCAGTTGGCAGACTCT
ACAGCTGCAGAACCTCCAAGTTCAGAACCCACAAGCCCAAACAATCACCTTAGCCCCAATGCAGGGTGTT
TCCTTGGGGCAGACCAGCAGCAGCAACACCACTCTCACACCCATTGCCTCAGCTGCTTCCATTCCTGCTG
GCACAGTCACTGTGAATGCTGCTCAACTCTCCTCCATGCCAGGCCTCCAGACCATTAACCTCAGTGCATT
GGGTACTTCAGGAATCCAGGTGCACCCAATTCAAGGCCTGCCGTTGGCTATAGCAAATGCCCCAGGTGAT
CATGGAGCTCAGCTTGGTCTCCATGGGGCTGGTGGTGATGGAATACATGATGACACAGCAGGTGGAGAGG
AAGGAGAAAACAGCCCAGATGCCCAACCCCAAGCCGGTCGGAGGACCCGGCGGGAAGCATGCACCTGCCC
CTACTGTAAAGACAGTGAAGGAAGGGGCTCGGGGGATCCTGGCAAAAAGAAACAGCATATTTGCCACATC
CAAGGCTGTGGGAAAGTGTATGGCAAGACCTCTCACCTGCGGGCACACTTGCGCTGGCATACAGGCGAGA
GGCCATTTATGTGTACCTGGTCATACTGTGGGAAACGCTTCACACGTTCGGATGAGCTACAGAGGCACAA
ACGTACACACACAGGTGAGAAGAAATTTGCCTGCCCTGAGTGTCCTAAGCGCTTCATGAGGAGTGACCAC
CTGTCAAAACATATCAAGACCCACCAGAATAAGAAGGGAGGCCCAGGTGTAGCTCTGAGTGTGGGCACTT
TGCCCCTGGACAGTGGGGCAGGTTCAGAAGGCAGTGGCACTGCCACTCCTTCAGCCCTTATTACCACCAA
TATGGTAGCCATGGAGGCCATCTGTCCAGAGGGCATTGCCCGTCTTGCCAACAGTGGCATCAACGTCATG
CAGGTGGCAGATCTGCAGTCCATTAATATCAGTGGCAATGGCTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209154 representing NM_138473
Red=Cloning site Green=Tags(s)

MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSR
IESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNR
TVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGA
NQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPS
SQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTN
SQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL
SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGV
SLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGD
HGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHI
QGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDH
LSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVM
QVADLQSINISGNGF

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_138473
ORF Size 2355 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_138473.2, NP_612482
RefSeq Size 7667
Locus ID 6667
Cytogenetics 12q13.13
Protein Families Stem cell relevant signaling - JAK/STAT signaling pathway, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transcription Factors, Druggable Genome
Protein Pathways TGF-beta signaling pathway, Huntington's disease
Gene Summary The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.