GPCR MRGX2(MRGPRX2) (NM_054030) Human Tagged ORF Clone

CAT#: RG209033

MRGPRX2 (GFP-tagged) - Human MAS-related GPR, member X2 (MRGPRX2)

Change vector?

  • TrueORF®

USD 546


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPCR MRGX2(MRGPRX2) (NM_054030) Human Tagged ORF Clone
Symbol MRGPRX2
Synonyms MGRG3; MRGX2
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG209033 representing NM_054030
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCCAACCACCCCGGCCTGGGGAACAGAAAGTACAACAGTGAATGGAAATGACCAAGCCCTTCTTC
TGCTTTGTGGCAAGGAGACCCTGATCCCGGTCTTCCTGATCCTTTTCATTGCCCTGGTCGGGCTGGTAGG
AAACGGGTTTGTGCTCTGGCTCCTGGGCTTCCGCATGCGCAGGAACGCCTTCTCTGTCTACGTCCTCAGC
CTGGCCGGGGCCGACTTCCTCTTCCTCTGCTTCCAGATTATAAATTGCCTGGTGTACCTCAGTAACTTCT
TCTGTTCCATCTCCATCAATTTCCCTAGCTTCTTCACCACTGTGATGACCTGTGCCTACCTTGCAGGCCT
GAGCATGCTGAGCACCGTCAGCACCGAGCGCTGCCTGTCCGTCCTGTGGCCCATCTGGTATCGCTGCCGC
CGCCCCAGACACCTGTCAGCGGTCGTGTGTGTCCTGCTCTGGGCCCTGTCCCTACTGCTGAGCATCTTGG
AAGGGAAGTTCTGTGGCTTCTTATTTAGTGATGGTGACTCTGGTTGGTGTCAGACATTTGATTTCATCAC
TGCAGCGTGGCTGATTTTTTTATTCATGGTTCTCTGTGGGTCCAGTCTGGCCCTGCTGGTCAGGATCCTC
TGTGGCTCCAGGGGTCTGCCACTGACCAGGCTGTACCTGACCATCCTGCTCACAGTGCTGGTGTTCCTCC
TCTGCGGCCTGCCCTTTGGCATTCAGTGGTTCCTAATATTATGGATCTGGAAGGATTCTGATGTCTTATT
TTGTCATATTCATCCAGTTTCAGTTGTCCTGTCATCTCTTAACAGCAGTGCCAACCCCATCATTTACTTC
TTCGTGGGCTCTTTTAGGAAGCAGTGGCGGCTGCAGCAGCCGATCCTCAAGCTGGCTCTCCAGAGGGCTC
TGCAGGACATTGCTGAGGTGGATCACAGTGAAGGATGCTTCCGTCAGGGCACCCCGGAGATGTCGAGAAG
CAGTCTGGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209033 representing NM_054030
Red=Cloning site Green=Tags(s)

MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLS
LAGADFLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTERCLSVLWPIWYRCR
RPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVLCGSSLALLVRIL
CGSRGLPLTRLYLTILLTVLVFLLCGLPFGIQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYF
FVGSFRKQWRLQQPILKLALQRALQDIAEVDHSEGCFRQGTPEMSRSSLV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_054030
ORF Size 990 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_054030.2, NP_473371
RefSeq Size 2130
RefSeq ORF 993
Locus ID 117194
Cytogenetics 11p15.1
Protein Families GPCR, Transmembrane, Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.