GCSF Receptor(CSF3R) (NM_000760) Human Tagged ORF Clone

CAT#: RG208790

CSF3R (GFP-tagged) - Human colony stimulating factor 3 receptor (granulocyte) (CSF3R), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GCSF Receptor(CSF3R) (NM_000760) Human Tagged ORF Clone
Symbol CSF3R
Synonyms CD114; GCSFR
Vector pCMV6-AC-GFP
Sequence Data
>RG208790 representing NM_000760
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAAGGCTGGGAAACTGCAGCCTGACTTGGGCTGCCCTGATCATCCTGCTGCTCCCCGGAAGTCTGG
AGGAGTGCGGGCACATCAGTGTCTCAGCCCCCATCGTCCACCTGGGGGATCCCATCACAGCCTCCTGCAT
CATCAAGCAGAACTGCAGCCATCTGGACCCGGAGCCACAGATTCTGTGGAGACTGGGAGCAGAGCTTCAG
CCCGGGGGCAGGCAGCAGCGTCTGTCTGATGGGACCCAGGAATCTATCATCACCCTGCCCCACCTCAACC
ACACTCAGGCCTTTCTCTCCTGCTGCCTGAACTGGGGCAACAGCCTGCAGATCCTGGACCAGGTTGAGCT
GCGCGCAGGCTACCCTCCAGCCATACCCCACAACCTCTCCTGCCTCATGAACCTCACAACCAGCAGCCTC
ATCTGCCAGTGGGAGCCAGGACCTGAGACCCACCTACCCACCAGCTTCACTCTGAAGAGTTTCAAGAGCC
GGGGCAACTGTCAGACCCAAGGGGACTCCATCCTGGACTGCGTGCCCAAGGACGGGCAGAGCCACTGCTG
CATCCCACGCAAACACCTGCTGTTGTACCAGAATATGGGCATCTGGGTGCAGGCAGAGAATGCGCTGGGG
ACCAGCATGTCCCCACAACTGTGTCTTGATCCCATGGATGTTGTGAAACTGGAGCCCCCCATGCTGCGGA
CCATGGACCCCAGCCCTGAAGCGGCCCCTCCCCAGGCAGGCTGCCTACAGCTGTGCTGGGAGCCATGGCA
GCCAGGCCTGCACATAAATCAGAAGTGTGAGCTGCGCCACAAGCCGCAGCGTGGAGAAGCCAGCTGGGCA
CTGGTGGGCCCCCTCCCCTTGGAGGCCCTTCAGTATGAGCTCTGCGGGCTCCTCCCAGCCACGGCCTACA
CCCTGCAGATACGCTGCATCCGCTGGCCCCTGCCTGGCCACTGGAGCGACTGGAGCCCCAGCCTGGAGCT
GAGAACTACCGAACGGGCCCCCACTGTCAGACTGGACACATGGTGGCGGCAGAGGCAGCTGGACCCCAGG
ACAGTGCAGCTGTTCTGGAAGCCAGTGCCCCTGGAGGAAGACAGCGGACGGATCCAAGGTTATGTGGTTT
CTTGGAGACCCTCAGGCCAGGCTGGGGCCATCCTGCCCCTCTGCAACACCACAGAGCTCAGCTGCACCTT
CCACCTGCCTTCAGAAGCCCAGGAGGTGGCCCTTGTGGCCTATAACTCAGCCGGGACCTCTCGTCCCACT
CCGGTGGTCTTCTCAGAAAGCAGAGGCCCAGCTCTGACCAGACTCCATGCCATGGCCCGAGACCCTCACA
GCCTCTGGGTAGGCTGGGAGCCCCCCAATCCATGGCCTCAGGGCTATGTGATTGAGTGGGGCCTGGGCCC
CCCCAGCGCGAGCAATAGCAACAAGACCTGGAGGATGGAACAGAATGGGAGAGCCACGGGGTTTCTGCTG
AAGGAGAACATCAGGCCCTTTCAGCTCTATGAGATCATCGTGACTCCCTTGTACCAGGACACCATGGGAC
CCTCCCAGCATGTCTATGCCTACTCTCAAGAAATGGCTCCCTCCCATGCCCCAGAGCTGCATCTAAAGCA
CATTGGCAAGACCTGGGCACAGCTGGAGTGGGTGCCTGAGCCCCCTGAGCTGGGGAAGAGCCCCCTTACC
CACTACACCATCTTCTGGACCAACGCTCAGAACCAGTCCTTCTCCGCCATCCTGAATGCCTCCTCCCGTG
GCTTTGTCCTCCATGGCCTGGAGCCCGCCAGTCTGTATCACATCCACCTCATGGCTGCCAGCCAGGCTGG
GGCCACCAACAGTACAGTCCTCACCCTGATGACCTTGACCCCAGAGGGGTCGGAGCTACACATCATCCTG
GGCCTGTTCGGCCTCCTGCTGTTGCTCACCTGCCTCTGTGGAACTGCCTGGCTCTGTTGCAGCCCCAACA
GGAAGAATCCCCTCTGGCCAAGTGTCCCAGACCCAGCTCACAGCAGCCTGGGCTCCTGGGTGCCCACAAT
CATGGAGGAGGATGCCTTCCAGCTGCCCGGCCTTGGCACGCCACCCATCACCAAGCTCACAGTGCTGGAG
GAGGATGAAAAGAAGCCGGTGCCCTGGGAGTCCCATAACAGCTCAGAGACCTGTGGCCTCCCCACTCTGG
TCCAGACCTATGTGCTCCAGGGGGACCCAAGAGCAGTTTCCACCCAGCCCCAATCCCAGTCTGGCACCAG
CGATCAGGTCCTTTATGGGCAGCTGCTGGGCAGCCCCACAAGCCCAGGGCCAGGGCACTATCTCCGCTGT
GACTCCACTCAGCCCCTCTTGGCGGGCCTCACCCCCAGCCCCAAGTCCTATGAGAACCTCTGGTTCCAGG
CCAGCCCCTTGGGGACCCTGGTAACCCCAGCCCCAAGCCAGGAGGACGACTGTGTCTTTGGGCCACTGCT
CAACTTCCCCCTCCTGCAGGGGATCCGGGTCCATGGGATGGAGGCGCTGGGGAGCTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG208790 representing NM_000760
Red=Cloning site Green=Tags(s)

MARLGNCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQ
PGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMNLTTSSL
ICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALG
TSMSPQLCLDPMDVVKLEPPMLRTMDPSPEAAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWA
LVGPLPLEALQYELCGLLPATAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPR
TVQLFWKPVPLEEDSGRIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRMEQNGRATGFLL
KENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGKTWAQLEWVPEPPELGKSPLT
HYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHLMAASQAGATNSTVLTLMTLTPEGSELHIIL
GLFGLLLLLTCLCGTAWLCCSPNRKNPLWPSVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLE
EDEKKPVPWESHNSSETCGLPTLVQTYVLQGDPRAVSTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRC
DSTQPLLAGLTPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLNFPLLQGIRVHGMEALGSF

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000760
ORF Size 2508 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000760.2, NP_000751
RefSeq Size 3003
RefSeq ORF 2511
Locus ID 1441
Cytogenetics 1p34.3
Domains FN3
Protein Families Secreted Protein, ES Cell Differentiation/IPS, Transmembrane, Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Hematopoietic cell lineage, Pathways in cancer
Gene Summary The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia. [provided by RefSeq, Aug 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)