EIF4EBP2 (NM_004096) Human Tagged ORF Clone

CAT#: RG208664

Reviews ()
Write a review
  • TrueORF®

EIF4EBP2 (GFP-tagged) - Human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 350.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol EIF4EBP2
Synonyms 4EBP2; PHASII
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG208664 representing NM_004096
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCGTCAGCCGGCAGCGGCCACCAGCCCAGCCAGAGCCGCGCCATCCCCACCCGCACCGTGGCCA
TCAGCGACGCCGCGCAGCTACCTCATGACTATTGCACCACGCCCGGGGGGACGCTCTTCTCCACCACACC
GGGAGGAACTCGAATCATTTATGACAGAAAGTTTCTGTTGGATCGTCGCAATTCTCCCATGGCTCAGACC
CCACCCTGCCACCTGCCCAATATCCCAGGAGTCACTAGCCCTGGCACCTTAATTGAAGACTCCAAAGTAG
AAGTAAACAATTTGAACAACTTGAACAATCACGACAGGAAACATGCAGTTGGGGATGATGCTCAGTTCGA
GATGGACATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG208664 representing NM_004096
Red=Cloning site Green=Tags(s)

MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQT
PPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004096
ORF Size 360 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004096.5
RefSeq Size 2782 bp
RefSeq ORF 363 bp
Locus ID 1979
UniProt ID Q13542
Cytogenetics 10q22.1
Protein Families Transcription Factors
Gene Summary This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq, Oct 2008]
Other products for "EIF4EBP2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.