CD163 (NM_004244) Human Tagged ORF Clone

CAT#: RG208557

CD163 (GFP-tagged) - Human CD163 molecule (CD163), transcript variant 1

Change vector?

  • TrueORF®

USD 917.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CD163 (NM_004244) Human Tagged ORF Clone
Symbol CD163
Synonyms M130; MM130; SCARI1
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG208557 representing NM_004244
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAAACTCAGAATGGTGCTACTTGAAGACTCTGGATCTGCTGACTTCAGAAGACATTTTGTCAACT
TGAGTCCCTTCACCATTACTGTGGTCTTACTTCTCAGTGCCTGTTTTGTCACCAGTTCTCTTGGAGGAAC
AGACAAGGAGCTGAGGCTAGTGGATGGTGAAAACAAGTGTAGCGGGAGAGTGGAAGTGAAAGTCCAGGAG
GAGTGGGGAACGGTGTGTAATAATGGCTGGAGCATGGAAGCGGTCTCTGTGATTTGTAACCAGCTGGGAT
GTCCAACTGCTATCAAAGCCCCTGGATGGGCTAATTCCAGTGCAGGTTCTGGACGCATTTGGATGGATCA
TGTTTCTTGTCGTGGGAATGAGTCAGCTCTTTGGGATTGCAAACATGATGGATGGGGAAAGCATAGTAAC
TGTACTCACCAACAAGATGCTGGAGTGACCTGCTCAGATGGATCCAATTTGGAAATGAGGCTGACGCGTG
GAGGGAATATGTGTTCTGGAAGAATAGAGATCAAATTCCAAGGACGGTGGGGAACAGTGTGTGATGATAA
CTTCAACATAGATCATGCATCTGTCATTTGTAGACAACTTGAATGTGGAAGTGCTGTCAGTTTCTCTGGT
TCATCTAATTTTGGAGAAGGCTCTGGACCAATCTGGTTTGATGATCTTATATGCAACGGAAATGAGTCAG
CTCTCTGGAACTGCAAACATCAAGGATGGGGAAAGCATAACTGTGATCATGCTGAGGATGCTGGAGTGAT
TTGCTCAAAGGGAGCAGATCTGAGCCTGAGACTGGTAGATGGAGTCACTGAATGTTCAGGAAGATTAGAA
GTGAGATTCCAAGGAGAATGGGGGACAATATGTGATGACGGCTGGGACAGTTACGATGCTGCTGTGGCAT
GCAAGCAACTGGGATGTCCAACTGCCGTCACAGCCATTGGTCGAGTTAACGCCAGTAAGGGATTTGGACA
CATCTGGCTTGACAGCGTTTCTTGCCAGGGACATGAACCTGCTGTCTGGCAATGTAAACACCATGAATGG
GGAAAGCATTATTGCAATCACAATGAAGATGCTGGCGTGACATGTTCTGATGGATCAGATCTGGAGCTAA
GACTTAGAGGTGGAGGCAGCCGCTGTGCTGGGACAGTTGAGGTGGAGATTCAGAGACTGTTAGGGAAGGT
GTGTGACAGAGGCTGGGGACTGAAAGAAGCTGATGTGGTTTGCAGGCAGCTGGGATGTGGATCTGCACTC
AAAACATCTTATCAAGTGTACTCCAAAATCCAGGCAACAAACACATGGCTGTTTCTAAGTAGCTGTAACG
GAAATGAAACTTCTCTTTGGGACTGCAAGAACTGGCAATGGGGTGGACTTACCTGTGATCACTATGAAGA
AGCCAAAATTACCTGCTCAGCCCACAGGGAACCCAGACTGGTTGGAGGGGACATTCCCTGTTCTGGACGT
GTTGAAGTGAAGCATGGTGACACGTGGGGCTCCATCTGTGATTCGGACTTCTCTCTGGAAGCTGCCAGCG
TTCTATGCAGGGAATTACAGTGTGGCACAGTTGTCTCTATCCTGGGGGGAGCTCACTTTGGAGAGGGAAA
TGGACAGATCTGGGCTGAAGAATTCCAGTGTGAGGGACATGAGTCCCATCTTTCACTCTGCCCAGTAGCA
CCCCGCCCAGAAGGAACTTGTAGCCACAGCAGGGATGTTGGAGTAGTCTGCTCAAGATACACAGAAATTC
GCTTGGTGAATGGCAAGACCCCGTGTGAGGGCAGAGTGGAGCTCAAAACGCTTGGTGCCTGGGGATCCCT
CTGTAACTCTCACTGGGACATAGAAGATGCCCATGTTCTTTGCCAGCAGCTTAAATGTGGAGTTGCCCTT
TCTACCCCAGGAGGAGCACGTTTTGGAAAAGGAAATGGTCAGATCTGGAGGCATATGTTTCACTGCACTG
GGACTGAGCAGCACATGGGAGATTGTCCTGTAACTGCTCTAGGTGCTTCATTATGTCCTTCAGAGCAAGT
GGCCTCTGTAATCTGCTCAGGAAACCAGTCCCAAACACTGTCCTCGTGCAATTCATCGTCTTTGGGCCCA
ACAAGGCCTACCATTCCAGAAGAAAGTGCTGTGGCCTGCATAGAGAGTGGTCAACTTCGCCTGGTAAATG
GAGGAGGTCGCTGTGCTGGGAGAGTAGAGATCTATCATGAGGGCTCCTGGGGCACCATCTGTGATGACAG
CTGGGACCTGAGTGATGCCCACGTGGTTTGCAGACAGCTGGGCTGTGGAGAGGCCATTAATGCCACTGGT
TCTGCTCATTTTGGGGAAGGAACAGGGCCCATCTGGCTGGATGAGATGAAATGCAATGGAAAAGAATCCC
GCATTTGGCAGTGCCATTCACACGGCTGGGGGCAGCAAAATTGCAGGCACAAGGAGGATGCGGGAGTTAT
CTGCTCAGAATTCATGTCTCTGAGACTGACCAGTGAAGCCAGCAGAGAGGCCTGTGCAGGGCGTCTGGAA
GTTTTTTACAATGGAGCTTGGGGCACTGTTGGCAAGAGTAGCATGTCTGAAACCACTGTGGGTGTGGTGT
GCAGGCAGCTGGGCTGTGCAGACAAAGGGAAAATCAACCCTGCATCTTTAGACAAGGCCATGTCCATTCC
CATGTGGGTGGACAATGTTCAGTGTCCAAAAGGACCTGACACGCTGTGGCAGTGCCCATCATCTCCATGG
GAGAAGAGACTGGCCAGCCCCTCGGAGGAGACCTGGATCACATGTGACAACAAGATAAGACTTCAGGAAG
GACCCACTTCCTGTTCTGGACGTGTGGAGATCTGGCATGGAGGTTCCTGGGGGACAGTGTGTGATGACTC
TTGGGACTTGGACGATGCTCAGGTGGTGTGTCAACAACTTGGCTGTGGTCCAGCTTTGAAAGCATTCAAA
GAAGCAGAGTTTGGTCAGGGGACTGGACCGATATGGCTCAATGAAGTGAAGTGCAAAGGGAATGAGTCTT
CCTTGTGGGATTGTCCTGCCAGACGCTGGGGCCATAGTGAGTGTGGGCACAAGGAAGACGCTGCAGTGAA
TTGCACAGATATTTCAGTGCAGAAAACCCCACAAAAAGCCACAACAGGTCGCTCATCCCGTCAGTCATCC
TTTATTGCAGTCGGGATCCTTGGGGTTGTTCTGTTGGCCATTTTCGTCGCATTATTCTTCTTGACTAAAA
AGCGAAGACAGAGACAGCGGCTTGCAGTTTCCTCAAGAGGAGAGAACTTAGTCCACCAAATTCAATACCG
GGAGATGAATTCTTGCCTGAATGCAGATGATCTGGACCTAATGAATTCCTCAGAAAATTCCCATGAGTCA
GCTGATTTCAGTGCTGCTGAACTAATTTCTGTGTCTAAATTTCTTCCTATTTCTGGAATGGAAAAGGAGG
CCATTCTGAGCCACACTGAAAAGGAAAATGGGAATTTA


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208557 representing NM_004244
Red=Cloning site Green=Tags(s)

MSKLRMVLLEDSGSADFRRHFVNLSPFTITVVLLLSACFVTSSLGGTDKELRLVDGENKCSGRVEVKVQE
EWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSN
CTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSG
SSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLE
VRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEW
GKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQLGCGSAL
KTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDHYEEAKITCSAHREPRLVGGDIPCSGR
VEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQIWAEEFQCEGHESHLSLCPVA
PRPEGTCSHSRDVGVVCSRYTEIRLVNGKTPCEGRVELKTLGAWGSLCNSHWDIEDAHVLCQQLKCGVAL
STPGGARFGKGNGQIWRHMFHCTGTEQHMGDCPVTALGASLCPSEQVASVICSGNQSQTLSSCNSSSLGP
TRPTIPEESAVACIESGQLRLVNGGGRCAGRVEIYHEGSWGTICDDSWDLSDAHVVCRQLGCGEAINATG
SAHFGEGTGPIWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSLRLTSEASREACAGRLE
VFYNGAWGTVGKSSMSETTVGVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPKGPDTLWQCPSSPW
EKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDLDDAQVVCQQLGCGPALKAFK
EAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHSECGHKEDAAVNCTDISVQKTPQKATTGRSSRQSS
FIAVGILGVVLLAIFVALFFLTKKRRQRQRLAVSSRGENLVHQIQYREMNSCLNADDLDLMNSSENSHES
ADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_004244
ORF Size 3468 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004244.3, NP_004235
RefSeq Size 3806
Locus ID 9332
Cytogenetics 12p13.31
Domains SR
Protein Families Secreted Protein, Transmembrane, Druggable Genome
Gene Summary The protein encoded by this gene is a member of the scavenger receptor cysteine-rich (SRCR) superfamily, and is exclusively expressed in monocytes and macrophages. It functions as an acute phase-regulated receptor involved in the clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages, and may thereby protect tissues from free hemoglobin-mediated oxidative damage. This protein may also function as an innate immune sensor for bacteria and inducer of local inflammation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations